Serveur d'exploration MERS

Attention, ce site est en cours de développement !
Attention, site généré par des moyens informatiques à partir de corpus bruts.
Les informations ne sont donc pas validées.

Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology

Identifieur interne : 000685 ( Istex/Corpus ); précédent : 000684; suivant : 000686

Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology

Auteurs : Peter Timmerman ; Evert Van Dijk ; Wouter Puijk ; Wim Schaaper ; Jerry Slootstra ; Stephen J. Carlisle ; John Coley ; Steve Eida ; M. Gani ; Tim Hunt ; Paul Perry ; Gerry Piron ; Rob H. Meloen

Source :

RBID : ISTEX:CDFAACC91736BF8468E37BDB8FA45EB2D00F466B

English descriptors

Abstract

Abstract: This paper describes the application of two novel screening technologies, i.e. Domain Scan™ (24- and 30-mer peptides) and Matrix Scan™ (24-mer peptides)technology, in the mapping of a discontinuous epitope on FSH-β for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan™ technology (12-merpeptides), showed selective binding to peptide-constructs corresponding to the β3-loop of FSH in the Domain™ and/or Matrix Scan™. Systematic replacement analysis studies with peptide-construct 57VYETVRVPGCAC-SAc-ADSLYTYPVATQ81 revealed that for most mAb's the amino acids R62, A70,D71, and L73 form the core of the epitope. A DomainScan™ performed in the C-O format showed highly selective binding for mAb's 1 and 2 with only three β1-β3 peptide-constructs covering the residues 60TVRVPGCAHHADSLY74 in combination with 10IAIEKEECRFAI21, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues97RGLGPSYCSFGEMKE114 in combination with the residues 10IAIEKEECRFAI21. A Matrix Scan™ of mAb 17 showed that peptides from four different regions on FSH (1st strand β3-loop, α1-loop, longα2-loop, det. loop) showed enhanced binding in combination with several 70ADSL73-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and MatrixScan™ screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the β3-loop showed measurable binding. Cyclic β3-loop peptide mimics were found to bind significantly stronger (Kd∼ 5 μM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair β1-peptide 10IAIEKEECRFAI21to the linear β3-peptide*52TFKELVYETVRVPGCAHHADSLYTYPVATQAH83# via disulfide bond formation showed a 2–3 fold increase in Kd, thus conforming participation of the β 1-loop in antibody binding for these mAb's.

Url:
DOI: 10.1023/B:MODI.0000025650.94399.bb

Links to Exploration step

ISTEX:CDFAACC91736BF8468E37BDB8FA45EB2D00F466B

Le document en format XML

<record>
<TEI wicri:istexFullTextTei="biblStruct">
<teiHeader>
<fileDesc>
<titleStmt>
<title xml:lang="en">Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
<author>
<name sortKey="Timmerman, Peter" sort="Timmerman, Peter" uniqKey="Timmerman P" first="Peter" last="Timmerman">Peter Timmerman</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
<affiliation>
<mods:affiliation>E-mail: p.timmerman@pepscan.nl</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Van Dijk, Evert" sort="Van Dijk, Evert" uniqKey="Van Dijk E" first="Evert" last="Van Dijk">Evert Van Dijk</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Puijk, Wouter" sort="Puijk, Wouter" uniqKey="Puijk W" first="Wouter" last="Puijk">Wouter Puijk</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Schaaper, Wim" sort="Schaaper, Wim" uniqKey="Schaaper W" first="Wim" last="Schaaper">Wim Schaaper</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Slootstra, Jerry" sort="Slootstra, Jerry" uniqKey="Slootstra J" first="Jerry" last="Slootstra">Jerry Slootstra</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Carlisle, Stephen J" sort="Carlisle, Stephen J" uniqKey="Carlisle S" first="Stephen J." last="Carlisle">Stephen J. Carlisle</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Coley, John" sort="Coley, John" uniqKey="Coley J" first="John" last="Coley">John Coley</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Eida, Steve" sort="Eida, Steve" uniqKey="Eida S" first="Steve" last="Eida">Steve Eida</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Gani, M" sort="Gani, M" uniqKey="Gani M" first="M." last="Gani">M. Gani</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Hunt, Tim" sort="Hunt, Tim" uniqKey="Hunt T" first="Tim" last="Hunt">Tim Hunt</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Perry, Paul" sort="Perry, Paul" uniqKey="Perry P" first="Paul" last="Perry">Paul Perry</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Piron, Gerry" sort="Piron, Gerry" uniqKey="Piron G" first="Gerry" last="Piron">Gerry Piron</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Meloen, Rob H" sort="Meloen, Rob H" uniqKey="Meloen R" first="Rob H." last="Meloen">Rob H. Meloen</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
</titleStmt>
<publicationStmt>
<idno type="wicri:source">ISTEX</idno>
<idno type="RBID">ISTEX:CDFAACC91736BF8468E37BDB8FA45EB2D00F466B</idno>
<date when="2004" year="2004">2004</date>
<idno type="doi">10.1023/B:MODI.0000025650.94399.bb</idno>
<idno type="url">https://api.istex.fr/ark:/67375/VQC-KQRHF3Z9-6/fulltext.pdf</idno>
<idno type="wicri:Area/Istex/Corpus">000685</idno>
<idno type="wicri:explorRef" wicri:stream="Istex" wicri:step="Corpus" wicri:corpus="ISTEX">000685</idno>
</publicationStmt>
<sourceDesc>
<biblStruct>
<analytic>
<title level="a" type="main" xml:lang="en">Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
<author>
<name sortKey="Timmerman, Peter" sort="Timmerman, Peter" uniqKey="Timmerman P" first="Peter" last="Timmerman">Peter Timmerman</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
<affiliation>
<mods:affiliation>E-mail: p.timmerman@pepscan.nl</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Van Dijk, Evert" sort="Van Dijk, Evert" uniqKey="Van Dijk E" first="Evert" last="Van Dijk">Evert Van Dijk</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Puijk, Wouter" sort="Puijk, Wouter" uniqKey="Puijk W" first="Wouter" last="Puijk">Wouter Puijk</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Schaaper, Wim" sort="Schaaper, Wim" uniqKey="Schaaper W" first="Wim" last="Schaaper">Wim Schaaper</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Slootstra, Jerry" sort="Slootstra, Jerry" uniqKey="Slootstra J" first="Jerry" last="Slootstra">Jerry Slootstra</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Carlisle, Stephen J" sort="Carlisle, Stephen J" uniqKey="Carlisle S" first="Stephen J." last="Carlisle">Stephen J. Carlisle</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Coley, John" sort="Coley, John" uniqKey="Coley J" first="John" last="Coley">John Coley</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Eida, Steve" sort="Eida, Steve" uniqKey="Eida S" first="Steve" last="Eida">Steve Eida</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Gani, M" sort="Gani, M" uniqKey="Gani M" first="M." last="Gani">M. Gani</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Hunt, Tim" sort="Hunt, Tim" uniqKey="Hunt T" first="Tim" last="Hunt">Tim Hunt</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Perry, Paul" sort="Perry, Paul" uniqKey="Perry P" first="Paul" last="Perry">Paul Perry</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Piron, Gerry" sort="Piron, Gerry" uniqKey="Piron G" first="Gerry" last="Piron">Gerry Piron</name>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
<author>
<name sortKey="Meloen, Rob H" sort="Meloen, Rob H" uniqKey="Meloen R" first="Rob H." last="Meloen">Rob H. Meloen</name>
<affiliation>
<mods:affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</mods:affiliation>
</affiliation>
<affiliation>
<mods:affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</mods:affiliation>
</affiliation>
</author>
</analytic>
<monogr></monogr>
<series>
<title level="j">Molecular Diversity</title>
<title level="j" type="abbrev">Mol Divers</title>
<idno type="ISSN">1381-1991</idno>
<idno type="eISSN">1573-501X</idno>
<imprint>
<publisher>Kluwer Academic Publishers</publisher>
<pubPlace>Dordrecht</pubPlace>
<date type="published" when="2004-06-01">2004-06-01</date>
<biblScope unit="volume">8</biblScope>
<biblScope unit="issue">2</biblScope>
<biblScope unit="page" from="61">61</biblScope>
<biblScope unit="page" to="77">77</biblScope>
</imprint>
<idno type="ISSN">1381-1991</idno>
</series>
</biblStruct>
</sourceDesc>
<seriesStmt>
<idno type="ISSN">1381-1991</idno>
</seriesStmt>
</fileDesc>
<profileDesc>
<textClass>
<keywords scheme="KwdEn" xml:lang="en">
<term>affinity measurements</term>
<term>epitope mapping</term>
<term>fertility hormones</term>
<term>peptides</term>
</keywords>
</textClass>
<langUsage>
<language ident="en">en</language>
</langUsage>
</profileDesc>
</teiHeader>
<front>
<div type="abstract" xml:lang="en">Abstract: This paper describes the application of two novel screening technologies, i.e. Domain Scan™ (24- and 30-mer peptides) and Matrix Scan™ (24-mer peptides)technology, in the mapping of a discontinuous epitope on FSH-β for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan™ technology (12-merpeptides), showed selective binding to peptide-constructs corresponding to the β3-loop of FSH in the Domain™ and/or Matrix Scan™. Systematic replacement analysis studies with peptide-construct 57VYETVRVPGCAC-SAc-ADSLYTYPVATQ81 revealed that for most mAb's the amino acids R62, A70,D71, and L73 form the core of the epitope. A DomainScan™ performed in the C-O format showed highly selective binding for mAb's 1 and 2 with only three β1-β3 peptide-constructs covering the residues 60TVRVPGCAHHADSLY74 in combination with 10IAIEKEECRFAI21, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues97RGLGPSYCSFGEMKE114 in combination with the residues 10IAIEKEECRFAI21. A Matrix Scan™ of mAb 17 showed that peptides from four different regions on FSH (1st strand β3-loop, α1-loop, longα2-loop, det. loop) showed enhanced binding in combination with several 70ADSL73-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and MatrixScan™ screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the β3-loop showed measurable binding. Cyclic β3-loop peptide mimics were found to bind significantly stronger (Kd∼ 5 μM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair β1-peptide 10IAIEKEECRFAI21to the linear β3-peptide*52TFKELVYETVRVPGCAHHADSLYTYPVATQAH83# via disulfide bond formation showed a 2–3 fold increase in Kd, thus conforming participation of the β 1-loop in antibody binding for these mAb's.</div>
</front>
</TEI>
<istex>
<corpusName>springer-journals</corpusName>
<author>
<json:item>
<name>Peter Timmerman</name>
<affiliations>
<json:string>Pepscan Systems B.V., Lelystad, The Netherlands</json:string>
<json:string>E-mail: p.timmerman@pepscan.nl</json:string>
</affiliations>
</json:item>
<json:item>
<name>Evert Van Dijk</name>
<affiliations>
<json:string>Pepscan Systems B.V., Lelystad, The Netherlands</json:string>
</affiliations>
</json:item>
<json:item>
<name>Wouter Puijk</name>
<affiliations>
<json:string>Pepscan Systems B.V., Lelystad, The Netherlands</json:string>
</affiliations>
</json:item>
<json:item>
<name>Wim Schaaper</name>
<affiliations>
<json:string>Pepscan Systems B.V., Lelystad, The Netherlands</json:string>
</affiliations>
</json:item>
<json:item>
<name>Jerry Slootstra</name>
<affiliations>
<json:string>Pepscan Systems B.V., Lelystad, The Netherlands</json:string>
</affiliations>
</json:item>
<json:item>
<name>Stephen J. Carlisle</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>John Coley</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>Steve Eida</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>M. Gani</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>Tim Hunt</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>Paul Perry</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>Gerry Piron</name>
<affiliations>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
<json:item>
<name>Rob H. Meloen</name>
<affiliations>
<json:string>Pepscan Systems B.V., Lelystad, The Netherlands</json:string>
<json:string>Unipath Limited, Priory Business Park, Bedford, United Kingdom</json:string>
</affiliations>
</json:item>
</author>
<subject>
<json:item>
<lang>
<json:string>eng</json:string>
</lang>
<value>affinity measurements</value>
</json:item>
<json:item>
<lang>
<json:string>eng</json:string>
</lang>
<value>epitope mapping</value>
</json:item>
<json:item>
<lang>
<json:string>eng</json:string>
</lang>
<value>fertility hormones</value>
</json:item>
<json:item>
<lang>
<json:string>eng</json:string>
</lang>
<value>peptides</value>
</json:item>
</subject>
<articleId>
<json:string>5266955</json:string>
<json:string>Art2</json:string>
</articleId>
<arkIstex>ark:/67375/VQC-KQRHF3Z9-6</arkIstex>
<language>
<json:string>eng</json:string>
</language>
<originalGenre>
<json:string>OriginalPaper</json:string>
</originalGenre>
<abstract>Abstract: This paper describes the application of two novel screening technologies, i.e. Domain Scan™ (24- and 30-mer peptides) and Matrix Scan™ (24-mer peptides)technology, in the mapping of a discontinuous epitope on FSH-β for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan™ technology (12-merpeptides), showed selective binding to peptide-constructs corresponding to the β3-loop of FSH in the Domain™ and/or Matrix Scan™. Systematic replacement analysis studies with peptide-construct 57VYETVRVPGCAC-SAc-ADSLYTYPVATQ81 revealed that for most mAb's the amino acids R62, A70,D71, and L73 form the core of the epitope. A DomainScan™ performed in the C-O format showed highly selective binding for mAb's 1 and 2 with only three β1-β3 peptide-constructs covering the residues 60TVRVPGCAHHADSLY74 in combination with 10IAIEKEECRFAI21, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues97RGLGPSYCSFGEMKE114 in combination with the residues 10IAIEKEECRFAI21. A Matrix Scan™ of mAb 17 showed that peptides from four different regions on FSH (1st strand β3-loop, α1-loop, longα2-loop, det. loop) showed enhanced binding in combination with several 70ADSL73-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and MatrixScan™ screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the β3-loop showed measurable binding. Cyclic β3-loop peptide mimics were found to bind significantly stronger (Kd∼ 5 μM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair β1-peptide 10IAIEKEECRFAI21to the linear β3-peptide*52TFKELVYETVRVPGCAHHADSLYTYPVATQAH83# via disulfide bond formation showed a 2–3 fold increase in Kd, thus conforming participation of the β 1-loop in antibody binding for these mAb's.</abstract>
<qualityIndicators>
<score>10</score>
<pdfWordCount>8759</pdfWordCount>
<pdfCharCount>52226</pdfCharCount>
<pdfVersion>1.3</pdfVersion>
<pdfPageCount>17</pdfPageCount>
<pdfPageSize>595 x 842 pts (A4)</pdfPageSize>
<refBibsNative>false</refBibsNative>
<abstractWordCount>283</abstractWordCount>
<abstractCharCount>2017</abstractCharCount>
<keywordCount>4</keywordCount>
</qualityIndicators>
<title>Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
<genre>
<json:string>research-article</json:string>
</genre>
<host>
<title>Molecular Diversity</title>
<language>
<json:string>unknown</json:string>
</language>
<publicationDate>2004</publicationDate>
<copyrightDate>2004</copyrightDate>
<issn>
<json:string>1381-1991</json:string>
</issn>
<eissn>
<json:string>1573-501X</json:string>
</eissn>
<journalId>
<json:string>11030</json:string>
</journalId>
<volume>8</volume>
<issue>2</issue>
<pages>
<first>61</first>
<last>77</last>
</pages>
<genre>
<json:string>journal</json:string>
</genre>
<editor>
<json:item>
<name>Rob H. Meloen</name>
</json:item>
</editor>
<subject>
<json:item>
<value>Analytical Chemistry</value>
</json:item>
<json:item>
<value>Organic Chemistry</value>
</json:item>
<json:item>
<value>Polymer Sciences</value>
</json:item>
<json:item>
<value>Pharmacy</value>
</json:item>
</subject>
</host>
<ark>
<json:string>ark:/67375/VQC-KQRHF3Z9-6</json:string>
</ark>
<publicationDate>2004</publicationDate>
<copyrightDate>2004</copyrightDate>
<doi>
<json:string>10.1023/B:MODI.0000025650.94399.bb</json:string>
</doi>
<id>CDFAACC91736BF8468E37BDB8FA45EB2D00F466B</id>
<score>1</score>
<fulltext>
<json:item>
<extension>pdf</extension>
<original>true</original>
<mimetype>application/pdf</mimetype>
<uri>https://api.istex.fr/ark:/67375/VQC-KQRHF3Z9-6/fulltext.pdf</uri>
</json:item>
<json:item>
<extension>zip</extension>
<original>false</original>
<mimetype>application/zip</mimetype>
<uri>https://api.istex.fr/ark:/67375/VQC-KQRHF3Z9-6/bundle.zip</uri>
</json:item>
<istex:fulltextTEI uri="https://api.istex.fr/ark:/67375/VQC-KQRHF3Z9-6/fulltext.tei">
<teiHeader>
<fileDesc>
<titleStmt>
<title level="a" type="main" xml:lang="en">Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
</titleStmt>
<publicationStmt>
<authority>ISTEX</authority>
<publisher scheme="https://scientific-publisher.data.istex.fr">Kluwer Academic Publishers</publisher>
<pubPlace>Dordrecht</pubPlace>
<availability>
<licence>
<p>Kluwer Academic Publishers, 2004</p>
</licence>
<p scheme="https://loaded-corpus.data.istex.fr/ark:/67375/XBH-3XSW68JL-F">springer</p>
</availability>
<date>2004</date>
</publicationStmt>
<notesStmt>
<note type="research-article" scheme="https://content-type.data.istex.fr/ark:/67375/XTP-1JC4F85T-7">research-article</note>
<note type="journal" scheme="https://publication-type.data.istex.fr/ark:/67375/JMC-0GLKJH51-B">journal</note>
</notesStmt>
<sourceDesc>
<biblStruct type="inbook">
<analytic>
<title level="a" type="main" xml:lang="en">Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
<author xml:id="author-0000" corresp="yes">
<persName>
<forename type="first">Peter</forename>
<surname>Timmerman</surname>
</persName>
<email>p.timmerman@pepscan.nl</email>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
</author>
<author xml:id="author-0001">
<persName>
<forename type="first">Evert</forename>
<surname>Van Dijk</surname>
</persName>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
</author>
<author xml:id="author-0002">
<persName>
<forename type="first">Wouter</forename>
<surname>Puijk</surname>
</persName>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
</author>
<author xml:id="author-0003">
<persName>
<forename type="first">Wim</forename>
<surname>Schaaper</surname>
</persName>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
</author>
<author xml:id="author-0004">
<persName>
<forename type="first">Jerry</forename>
<surname>Slootstra</surname>
</persName>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
</author>
<author xml:id="author-0005">
<persName>
<forename type="first">Stephen</forename>
<surname>Carlisle</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0006">
<persName>
<forename type="first">John</forename>
<surname>Coley</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0007">
<persName>
<forename type="first">Steve</forename>
<surname>Eida</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0008">
<persName>
<forename type="first">M.</forename>
<surname>Gani</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0009">
<persName>
<forename type="first">Tim</forename>
<surname>Hunt</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0010">
<persName>
<forename type="first">Paul</forename>
<surname>Perry</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0011">
<persName>
<forename type="first">Gerry</forename>
<surname>Piron</surname>
</persName>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<author xml:id="author-0012">
<persName>
<forename type="first">Rob</forename>
<surname>Meloen</surname>
</persName>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
</author>
<idno type="istex">CDFAACC91736BF8468E37BDB8FA45EB2D00F466B</idno>
<idno type="ark">ark:/67375/VQC-KQRHF3Z9-6</idno>
<idno type="DOI">10.1023/B:MODI.0000025650.94399.bb</idno>
<idno type="article-id">5266955</idno>
<idno type="article-id">Art2</idno>
</analytic>
<monogr>
<title level="j">Molecular Diversity</title>
<title level="j" type="abbrev">Mol Divers</title>
<idno type="pISSN">1381-1991</idno>
<idno type="eISSN">1573-501X</idno>
<idno type="journal-ID">true</idno>
<idno type="issue-article-count">13</idno>
<idno type="volume-issue-count">4</idno>
<editor xml:id="book-author-0000">
<persName>
<forename type="first">Rob</forename>
<forename type="first">H.</forename>
<surname>Meloen</surname>
</persName>
</editor>
<imprint>
<publisher>Kluwer Academic Publishers</publisher>
<pubPlace>Dordrecht</pubPlace>
<date type="published" when="2004-06-01"></date>
<biblScope unit="volume">8</biblScope>
<biblScope unit="issue">2</biblScope>
<biblScope unit="page" from="61">61</biblScope>
<biblScope unit="page" to="77">77</biblScope>
</imprint>
</monogr>
</biblStruct>
</sourceDesc>
</fileDesc>
<profileDesc>
<creation>
<date>2004</date>
</creation>
<langUsage>
<language ident="en">en</language>
</langUsage>
<abstract xml:lang="en">
<p>Abstract: This paper describes the application of two novel screening technologies, i.e. Domain Scan™ (24- and 30-mer peptides) and Matrix Scan™ (24-mer peptides)technology, in the mapping of a discontinuous epitope on FSH-β for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan™ technology (12-merpeptides), showed selective binding to peptide-constructs corresponding to the β3-loop of FSH in the Domain™ and/or Matrix Scan™. Systematic replacement analysis studies with peptide-construct 57VYETVRVPGCAC-SAc-ADSLYTYPVATQ81 revealed that for most mAb's the amino acids R62, A70,D71, and L73 form the core of the epitope. A DomainScan™ performed in the C-O format showed highly selective binding for mAb's 1 and 2 with only three β1-β3 peptide-constructs covering the residues 60TVRVPGCAHHADSLY74 in combination with 10IAIEKEECRFAI21, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues97RGLGPSYCSFGEMKE114 in combination with the residues 10IAIEKEECRFAI21. A Matrix Scan™ of mAb 17 showed that peptides from four different regions on FSH (1st strand β3-loop, α1-loop, longα2-loop, det. loop) showed enhanced binding in combination with several 70ADSL73-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and MatrixScan™ screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the β3-loop showed measurable binding. Cyclic β3-loop peptide mimics were found to bind significantly stronger (Kd∼ 5 μM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair β1-peptide 10IAIEKEECRFAI21to the linear β3-peptide*52TFKELVYETVRVPGCAHHADSLYTYPVATQAH83# via disulfide bond formation showed a 2–3 fold increase in Kd, thus conforming participation of the β 1-loop in antibody binding for these mAb's.</p>
</abstract>
<textClass xml:lang="en">
<keywords scheme="keyword">
<list>
<item>
<term>affinity measurements</term>
</item>
<item>
<term>epitope mapping</term>
</item>
<item>
<term>fertility hormones</term>
</item>
<item>
<term>peptides</term>
</item>
</list>
</keywords>
</textClass>
<textClass>
<keywords scheme="Journal Subject">
<list>
<head>Chemistry</head>
<item>
<term>Analytical Chemistry</term>
</item>
<item>
<term>Organic Chemistry</term>
</item>
<item>
<term>Polymer Sciences</term>
</item>
<item>
<term>Pharmacy</term>
</item>
</list>
</keywords>
</textClass>
</profileDesc>
<revisionDesc>
<change when="2004-06-01">Published</change>
</revisionDesc>
</teiHeader>
</istex:fulltextTEI>
<json:item>
<extension>txt</extension>
<original>false</original>
<mimetype>text/plain</mimetype>
<uri>https://api.istex.fr/ark:/67375/VQC-KQRHF3Z9-6/fulltext.txt</uri>
</json:item>
</fulltext>
<metadata>
<istex:metadataXml wicri:clean="corpus springer-journals not found" wicri:toSee="no header">
<istex:xmlDeclaration>version="1.0" encoding="UTF-8"</istex:xmlDeclaration>
<istex:docType PUBLIC="-//Springer-Verlag//DTD A++ V2.4//EN" URI="http://devel.springer.de/A++/V2.4/DTD/A++V2.4.dtd" name="istex:docType"></istex:docType>
<istex:document>
<Publisher>
<PublisherInfo>
<PublisherName>Kluwer Academic Publishers</PublisherName>
<PublisherLocation>Dordrecht</PublisherLocation>
</PublisherInfo>
<Journal>
<JournalInfo JournalProductType="ArchiveJournal" NumberingStyle="Unnumbered">
<JournalID>11030</JournalID>
<JournalPrintISSN>1381-1991</JournalPrintISSN>
<JournalElectronicISSN>1573-501X</JournalElectronicISSN>
<JournalTitle>Molecular Diversity</JournalTitle>
<JournalAbbreviatedTitle>Mol Divers</JournalAbbreviatedTitle>
<JournalSubjectGroup>
<JournalSubject Type="Primary">Chemistry</JournalSubject>
<JournalSubject Type="Secondary">Analytical Chemistry</JournalSubject>
<JournalSubject Type="Secondary">Organic Chemistry</JournalSubject>
<JournalSubject Type="Secondary">Polymer Sciences</JournalSubject>
<JournalSubject Type="Secondary">Pharmacy</JournalSubject>
</JournalSubjectGroup>
</JournalInfo>
<Volume>
<VolumeInfo VolumeType="Regular" TocLevels="0">
<VolumeIDStart>8</VolumeIDStart>
<VolumeIDEnd>8</VolumeIDEnd>
<VolumeIssueCount>4</VolumeIssueCount>
</VolumeInfo>
<Issue IssueType="Regular">
<IssueInfo TocLevels="0">
<IssueIDStart>2</IssueIDStart>
<IssueIDEnd>2</IssueIDEnd>
<IssueTitle Language="En">Peptide Libraries and Peptide Drugs</IssueTitle>
<IssueArticleCount>13</IssueArticleCount>
<IssueHistory>
<CoverDate>
<DateString>2004</DateString>
<Year>2004</Year>
<Month>6</Month>
</CoverDate>
</IssueHistory>
<IssueCopyright>
<CopyrightHolderName>Kluwer Academic Publishers</CopyrightHolderName>
<CopyrightYear>2004</CopyrightYear>
</IssueCopyright>
</IssueInfo>
<IssueHeader>
<EditorGroup>
<Editor>
<EditorName DisplayOrder="Western">
<GivenName>Rob</GivenName>
<GivenName>H.</GivenName>
<FamilyName>Meloen</FamilyName>
</EditorName>
</Editor>
</EditorGroup>
</IssueHeader>
<Article ID="Art2">
<ArticleInfo Language="En" ArticleType="OriginalPaper" NumberingStyle="Unnumbered" TocLevels="0" ContainsESM="No">
<ArticleID>5266955</ArticleID>
<ArticleDOI>10.1023/B:MODI.0000025650.94399.bb</ArticleDOI>
<ArticleSequenceNumber>2</ArticleSequenceNumber>
<ArticleTitle Language="En">Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</ArticleTitle>
<ArticleFirstPage>61</ArticleFirstPage>
<ArticleLastPage>77</ArticleLastPage>
<ArticleHistory>
<RegistrationDate>
<Year>2004</Year>
<Month>10</Month>
<Day>2</Day>
</RegistrationDate>
</ArticleHistory>
<ArticleCopyright>
<CopyrightHolderName>Kluwer Academic Publishers</CopyrightHolderName>
<CopyrightYear>2004</CopyrightYear>
</ArticleCopyright>
<ArticleGrants Type="Regular">
<MetadataGrant Grant="OpenAccess"></MetadataGrant>
<AbstractGrant Grant="OpenAccess"></AbstractGrant>
<BodyPDFGrant Grant="Restricted"></BodyPDFGrant>
<BodyHTMLGrant Grant="Restricted"></BodyHTMLGrant>
<BibliographyGrant Grant="Restricted"></BibliographyGrant>
<ESMGrant Grant="Restricted"></ESMGrant>
</ArticleGrants>
<ArticleContext>
<JournalID>11030</JournalID>
<VolumeIDStart>8</VolumeIDStart>
<VolumeIDEnd>8</VolumeIDEnd>
<IssueIDStart>2</IssueIDStart>
<IssueIDEnd>2</IssueIDEnd>
</ArticleContext>
</ArticleInfo>
<ArticleHeader>
<AuthorGroup>
<Author AffiliationIDS="Aff1" CorrespondingAffiliationID="Aff1">
<AuthorName DisplayOrder="Western">
<GivenName>Peter</GivenName>
<FamilyName>Timmerman</FamilyName>
</AuthorName>
<Contact>
<Email>p.timmerman@pepscan.nl</Email>
</Contact>
</Author>
<Author AffiliationIDS="Aff1">
<AuthorName DisplayOrder="Western">
<GivenName>Evert</GivenName>
<FamilyName>Van Dijk</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff1">
<AuthorName DisplayOrder="Western">
<GivenName>Wouter</GivenName>
<FamilyName>Puijk</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff1">
<AuthorName DisplayOrder="Western">
<GivenName>Wim</GivenName>
<FamilyName>Schaaper</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff1">
<AuthorName DisplayOrder="Western">
<GivenName>Jerry</GivenName>
<FamilyName>Slootstra</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>Stephen</GivenName>
<GivenName>J.</GivenName>
<FamilyName>Carlisle</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>John</GivenName>
<FamilyName>Coley</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>Steve</GivenName>
<FamilyName>Eida</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>M.</GivenName>
<FamilyName>Gani</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>Tim</GivenName>
<FamilyName>Hunt</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>Paul</GivenName>
<FamilyName>Perry</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>Gerry</GivenName>
<FamilyName>Piron</FamilyName>
</AuthorName>
</Author>
<Author AffiliationIDS="Aff1 Aff2">
<AuthorName DisplayOrder="Western">
<GivenName>Rob</GivenName>
<GivenName>H.</GivenName>
<FamilyName>Meloen</FamilyName>
</AuthorName>
</Author>
<Affiliation ID="Aff1">
<OrgName>Pepscan Systems B.V.</OrgName>
<OrgAddress>
<City>Lelystad</City>
<Country>The Netherlands</Country>
</OrgAddress>
</Affiliation>
<Affiliation ID="Aff2">
<OrgName>Unipath Limited</OrgName>
<OrgAddress>
<Street>Priory Business Park</Street>
<City>Bedford</City>
<Country>United Kingdom</Country>
</OrgAddress>
</Affiliation>
</AuthorGroup>
<Abstract ID="Abs1" Language="En">
<Heading>Abstract</Heading>
<Para>This paper describes the application of two novel screening technologies, i.e. Domain Scan™ (24- and 30-mer peptides) and Matrix Scan™ (24-mer peptides)technology, in the mapping of a discontinuous epitope on FSH-β for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan™ technology (12-merpeptides), showed selective binding to peptide-constructs corresponding to the β3-loop of FSH in the Domain™ and/or Matrix Scan™. Systematic replacement analysis studies with peptide-construct
<Subscript>57</Subscript>
VYETVRVPGCA
<Emphasis Type="Bold">C</Emphasis>
-
<Emphasis Type="Bold">SAc</Emphasis>
-ADSLYTYPVATQ
<Subscript>81</Subscript>
revealed that for most mAb's the amino acids R
<Subscript>62</Subscript>
, A
<Subscript>70</Subscript>
,D
<Subscript>71</Subscript>
, and L
<Subscript>73</Subscript>
form the core of the epitope. A DomainScan™ performed in the
<Emphasis Type="Italic">C-O</Emphasis>
format showed highly selective binding for mAb's 1 and 2 with only three β1-β3 peptide-constructs covering the residues
<Subscript>60</Subscript>
TVRVPGCAHHADSLY
<Subscript>74</Subscript>
in combination with
<Subscript>10</Subscript>
IAIEKEECRFAI
<Subscript>21</Subscript>
, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues
<Subscript>97</Subscript>
RGLGPSYCSFGEMKE
<Subscript>114</Subscript>
in combination with the residues
<Subscript>10</Subscript>
IAIEKEECRFAI
<Subscript>21</Subscript>
. A Matrix Scan™ of mAb 17 showed that peptides from four different regions on FSH (1st strand β3-loop, α1-loop, longα2-loop, det. loop) showed enhanced binding in combination with several
<Subscript>70</Subscript>
ADSL
<Subscript>73</Subscript>
-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and MatrixScan™ screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the β3-loop showed measurable binding. Cyclic β3-loop peptide mimics were found to bind significantly stronger (K
<Subscript>d</Subscript>
∼ 5 μM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair β1-peptide
<Subscript>10</Subscript>
IAIEKEECRFAI
<Subscript>21</Subscript>
to the linear β3-peptide*
<Subscript>52</Subscript>
TFKELVYETVRVPGCAHHADSLYTYPVATQAH
<Subscript>83</Subscript>
# via disulfide bond formation showed a 2–3 fold increase in K
<Subscript>d</Subscript>
, thus conforming participation of the β 1-loop in antibody binding for these mAb's.</Para>
</Abstract>
<KeywordGroup Language="En">
<Keyword>affinity measurements</Keyword>
<Keyword>epitope mapping</Keyword>
<Keyword>fertility hormones</Keyword>
<Keyword>peptides</Keyword>
</KeywordGroup>
</ArticleHeader>
<NoBody></NoBody>
</Article>
</Issue>
</Volume>
</Journal>
</Publisher>
</istex:document>
</istex:metadataXml>
<mods version="3.6">
<titleInfo lang="en">
<title>Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
</titleInfo>
<titleInfo type="alternative" contentType="CDATA">
<title>Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology</title>
</titleInfo>
<name type="personal" displayLabel="corresp">
<namePart type="given">Peter</namePart>
<namePart type="family">Timmerman</namePart>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<affiliation>E-mail: p.timmerman@pepscan.nl</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Evert</namePart>
<namePart type="family">Van Dijk</namePart>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Wouter</namePart>
<namePart type="family">Puijk</namePart>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Wim</namePart>
<namePart type="family">Schaaper</namePart>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Jerry</namePart>
<namePart type="family">Slootstra</namePart>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Stephen</namePart>
<namePart type="given">J.</namePart>
<namePart type="family">Carlisle</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">John</namePart>
<namePart type="family">Coley</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Steve</namePart>
<namePart type="family">Eida</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">M.</namePart>
<namePart type="family">Gani</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Tim</namePart>
<namePart type="family">Hunt</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Paul</namePart>
<namePart type="family">Perry</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Gerry</namePart>
<namePart type="family">Piron</namePart>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<name type="personal">
<namePart type="given">Rob</namePart>
<namePart type="given">H.</namePart>
<namePart type="family">Meloen</namePart>
<affiliation>Pepscan Systems B.V., Lelystad, The Netherlands</affiliation>
<affiliation>Unipath Limited, Priory Business Park, Bedford, United Kingdom</affiliation>
<role>
<roleTerm type="text">author</roleTerm>
</role>
</name>
<typeOfResource>text</typeOfResource>
<genre type="research-article" displayLabel="OriginalPaper" authority="ISTEX" authorityURI="https://content-type.data.istex.fr" valueURI="https://content-type.data.istex.fr/ark:/67375/XTP-1JC4F85T-7">research-article</genre>
<originInfo>
<publisher>Kluwer Academic Publishers</publisher>
<place>
<placeTerm type="text">Dordrecht</placeTerm>
</place>
<dateIssued encoding="w3cdtf">2004-06-01</dateIssued>
<copyrightDate encoding="w3cdtf">2004</copyrightDate>
</originInfo>
<language>
<languageTerm type="code" authority="rfc3066">en</languageTerm>
<languageTerm type="code" authority="iso639-2b">eng</languageTerm>
</language>
<abstract lang="en">Abstract: This paper describes the application of two novel screening technologies, i.e. Domain Scan™ (24- and 30-mer peptides) and Matrix Scan™ (24-mer peptides)technology, in the mapping of a discontinuous epitope on FSH-β for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan™ technology (12-merpeptides), showed selective binding to peptide-constructs corresponding to the β3-loop of FSH in the Domain™ and/or Matrix Scan™. Systematic replacement analysis studies with peptide-construct 57VYETVRVPGCAC-SAc-ADSLYTYPVATQ81 revealed that for most mAb's the amino acids R62, A70,D71, and L73 form the core of the epitope. A DomainScan™ performed in the C-O format showed highly selective binding for mAb's 1 and 2 with only three β1-β3 peptide-constructs covering the residues 60TVRVPGCAHHADSLY74 in combination with 10IAIEKEECRFAI21, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues97RGLGPSYCSFGEMKE114 in combination with the residues 10IAIEKEECRFAI21. A Matrix Scan™ of mAb 17 showed that peptides from four different regions on FSH (1st strand β3-loop, α1-loop, longα2-loop, det. loop) showed enhanced binding in combination with several 70ADSL73-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and MatrixScan™ screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the β3-loop showed measurable binding. Cyclic β3-loop peptide mimics were found to bind significantly stronger (Kd∼ 5 μM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair β1-peptide 10IAIEKEECRFAI21to the linear β3-peptide*52TFKELVYETVRVPGCAHHADSLYTYPVATQAH83# via disulfide bond formation showed a 2–3 fold increase in Kd, thus conforming participation of the β 1-loop in antibody binding for these mAb's.</abstract>
<subject lang="en">
<topic>affinity measurements</topic>
<topic>epitope mapping</topic>
<topic>fertility hormones</topic>
<topic>peptides</topic>
</subject>
<relatedItem type="host">
<titleInfo>
<title>Molecular Diversity</title>
</titleInfo>
<titleInfo type="abbreviated">
<title>Mol Divers</title>
</titleInfo>
<name type="personal">
<namePart type="given">Rob</namePart>
<namePart type="given">H.</namePart>
<namePart type="family">Meloen</namePart>
<role>
<roleTerm type="text">editor</roleTerm>
</role>
</name>
<genre type="journal" authority="ISTEX" authorityURI="https://publication-type.data.istex.fr" valueURI="https://publication-type.data.istex.fr/ark:/67375/JMC-0GLKJH51-B">journal</genre>
<originInfo>
<publisher>Springer</publisher>
<dateIssued encoding="w3cdtf">2004-06-01</dateIssued>
<copyrightDate encoding="w3cdtf">2004</copyrightDate>
</originInfo>
<subject>
<genre>Chemistry</genre>
<topic>Analytical Chemistry</topic>
<topic>Organic Chemistry</topic>
<topic>Polymer Sciences</topic>
<topic>Pharmacy</topic>
</subject>
<identifier type="ISSN">1381-1991</identifier>
<identifier type="eISSN">1573-501X</identifier>
<identifier type="JournalID">11030</identifier>
<identifier type="IssueArticleCount">13</identifier>
<identifier type="VolumeIssueCount">4</identifier>
<part>
<date>2004</date>
<detail type="issue">
<title>Peptide Libraries and Peptide Drugs</title>
</detail>
<detail type="volume">
<number>8</number>
<caption>vol.</caption>
</detail>
<detail type="issue">
<number>2</number>
<caption>no.</caption>
</detail>
<extent unit="pages">
<start>61</start>
<end>77</end>
</extent>
</part>
<recordInfo>
<recordOrigin>Kluwer Academic Publishers, 2004</recordOrigin>
</recordInfo>
</relatedItem>
<identifier type="istex">CDFAACC91736BF8468E37BDB8FA45EB2D00F466B</identifier>
<identifier type="ark">ark:/67375/VQC-KQRHF3Z9-6</identifier>
<identifier type="DOI">10.1023/B:MODI.0000025650.94399.bb</identifier>
<identifier type="ArticleID">5266955</identifier>
<identifier type="ArticleID">Art2</identifier>
<accessCondition type="use and reproduction" contentType="copyright">Kluwer Academic Publishers, 2004</accessCondition>
<recordInfo>
<recordContentSource authority="ISTEX" authorityURI="https://loaded-corpus.data.istex.fr" valueURI="https://loaded-corpus.data.istex.fr/ark:/67375/XBH-3XSW68JL-F">springer</recordContentSource>
<recordOrigin>Kluwer Academic Publishers, 2004</recordOrigin>
</recordInfo>
</mods>
<json:item>
<extension>json</extension>
<original>false</original>
<mimetype>application/json</mimetype>
<uri>https://api.istex.fr/ark:/67375/VQC-KQRHF3Z9-6/record.json</uri>
</json:item>
</metadata>
<serie></serie>
</istex>
</record>

Pour manipuler ce document sous Unix (Dilib)

EXPLOR_STEP=$WICRI_ROOT/Sante/explor/MersV1/Data/Istex/Corpus
HfdSelect -h $EXPLOR_STEP/biblio.hfd -nk 000685 | SxmlIndent | more

Ou

HfdSelect -h $EXPLOR_AREA/Data/Istex/Corpus/biblio.hfd -nk 000685 | SxmlIndent | more

Pour mettre un lien sur cette page dans le réseau Wicri

{{Explor lien
   |wiki=    Sante
   |area=    MersV1
   |flux=    Istex
   |étape=   Corpus
   |type=    RBID
   |clé=     ISTEX:CDFAACC91736BF8468E37BDB8FA45EB2D00F466B
   |texte=   Mapping of a discontinuous and highly conformational binding site on follicle stimulating hormone subunit-β (FSH-β) using domain Scan™ and Matrix Scan™ technology
}}

Wicri

This area was generated with Dilib version V0.6.33.
Data generation: Mon Apr 20 23:26:43 2020. Site generation: Sat Mar 27 09:06:09 2021