Serveur d'exploration MERS - Checkpoint (Istex)

Index « Teeft.i » - entrée « Mep2 »
Attention, ce site est en cours de développement !
Attention, site généré par des moyens informatiques à partir de corpus bruts.
Les informations ne sont donc pas validées.
Meoh < Mep2 < Mepvdprlepwkhpgsqpkt acnncyckkccfhcqvcftkkglgisygrk krrqrrrapq dsethqvslskq  Facettes :

List of bibliographic references

Number of relevant bibliographic references: 1.
Ident.Authors (with country if any)Title
001D47 (1992) Kumud Majumder [Inde]Ligation-free gene synthesis by PCR: synthesis and mutagenesis at multiple loci of a chimeric gene encoding OmpA signal peptide and hirudin

Pour manipuler ce document sous Unix (Dilib)

EXPLOR_STEP=$WICRI_ROOT/Sante/explor/MersV1/Data/Istex/Checkpoint
HfdIndexSelect -h $EXPLOR_AREA/Data/Istex/Checkpoint/Teeft.i -k "Mep2" 
HfdIndexSelect -h $EXPLOR_AREA/Data/Istex/Checkpoint/Teeft.i  \
                -Sk "Mep2" \
         | HfdSelect -Kh $EXPLOR_AREA/Data/Istex/Checkpoint/biblio.hfd 

Pour mettre un lien sur cette page dans le réseau Wicri

{{Explor lien
   |wiki=    Sante
   |area=    MersV1
   |flux=    Istex
   |étape=   Checkpoint
   |type=    indexItem
   |index=    Teeft.i
   |clé=    Mep2
}}

Wicri

This area was generated with Dilib version V0.6.33.
Data generation: Mon Apr 20 23:26:43 2020. Site generation: Sat Mar 27 09:06:09 2021