Links to Exploration step
Le document en format XML
<record><TEI><teiHeader><fileDesc><titleStmt><title xml:lang="en">A highly conserved WDYPKCDRA epitope in the RNA directed RNA polymerase of human coronaviruses can be used as epitope-based universal vaccine design</title>
<author><name sortKey="Sharmin, Refat" sort="Sharmin, Refat" uniqKey="Sharmin R" first="Refat" last="Sharmin">Refat Sharmin</name>
<affiliation><nlm:aff id="I1">Department of Genetic Engineering and Biotechnology, University of Dhaka, Science Complex Building, Dhaka 1000, Bangladesh</nlm:aff>
</affiliation>
</author>
<author><name sortKey="Islam, Abul Bashar Mir Md Khademul" sort="Islam, Abul Bashar Mir Md Khademul" uniqKey="Islam A" first="Abul Bashar Mir Md Khademul" last="Islam">Abul Bashar Mir Md Khademul Islam</name>
<affiliation><nlm:aff id="I1">Department of Genetic Engineering and Biotechnology, University of Dhaka, Science Complex Building, Dhaka 1000, Bangladesh</nlm:aff>
</affiliation>
</author>
</titleStmt>
<publicationStmt><idno type="wicri:source">PMC</idno>
<idno type="pmid">24884408</idno>
<idno type="pmc">4041900</idno>
<idno type="url">http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4041900</idno>
<idno type="RBID">PMC:4041900</idno>
<idno type="doi">10.1186/1471-2105-15-161</idno>
<date when="2014">2014</date>
<idno type="wicri:Area/Pmc/Corpus">000391</idno>
<idno type="wicri:explorRef" wicri:stream="Pmc" wicri:step="Corpus" wicri:corpus="PMC">000391</idno>
</publicationStmt>
<sourceDesc><biblStruct><analytic><title xml:lang="en" level="a" type="main">A highly conserved WDYPKCDRA epitope in the RNA directed RNA polymerase of human coronaviruses can be used as epitope-based universal vaccine design</title>
<author><name sortKey="Sharmin, Refat" sort="Sharmin, Refat" uniqKey="Sharmin R" first="Refat" last="Sharmin">Refat Sharmin</name>
<affiliation><nlm:aff id="I1">Department of Genetic Engineering and Biotechnology, University of Dhaka, Science Complex Building, Dhaka 1000, Bangladesh</nlm:aff>
</affiliation>
</author>
<author><name sortKey="Islam, Abul Bashar Mir Md Khademul" sort="Islam, Abul Bashar Mir Md Khademul" uniqKey="Islam A" first="Abul Bashar Mir Md Khademul" last="Islam">Abul Bashar Mir Md Khademul Islam</name>
<affiliation><nlm:aff id="I1">Department of Genetic Engineering and Biotechnology, University of Dhaka, Science Complex Building, Dhaka 1000, Bangladesh</nlm:aff>
</affiliation>
</author>
</analytic>
<series><title level="j">BMC Bioinformatics</title>
<idno type="eISSN">1471-2105</idno>
<imprint><date when="2014">2014</date>
</imprint>
</series>
</biblStruct>
</sourceDesc>
</fileDesc>
<profileDesc><textClass></textClass>
</profileDesc>
</teiHeader>
<front><div type="abstract" xml:lang="en"><sec><title>Background</title>
<p>Coronaviruses are the diverse group of RNA virus. From 1960, six strains of human coronaviruses have emerged that includes SARS-CoV and the recent infection by deadly MERS-CoV which is now going to cause another outbreak. Prevention of these viruses is urgent and a universal vaccine for all strain could be a promising solution in this circumstance. In this study we aimed to design an epitope based vaccine against all strain of human coronavirus.</p>
</sec>
<sec><title>Results</title>
<p>Multiple sequence alignment (MSA) approach was employed among spike (S), membrane (M), enveloped (E) and nucleocapsid (N) protein and replicase polyprotein 1ab to identify which one is highly conserve in all coronaviruses strains. Next, we use various <italic>in silico</italic>
tools to predict consensus immunogenic and conserved peptide. We found that conserved region is present only in the RNA directed RNA polymerase protein. In this protein we identified one epitope WDYPKCDRA is highly immunogenic and 100% conserved among all available human coronavirus strains.</p>
</sec>
<sec><title>Conclusions</title>
<p>Here we suggest <italic>in vivo</italic>
study of our identified novel peptide antigen in RNA directed RNA polymerase protein for universal vaccine – which may be the way to prevent all human coronavirus disease.</p>
</sec>
</div>
</front>
<back><div1 type="bibliography"><listBibl><biblStruct><analytic><author><name sortKey="Luis, E" uniqKey="Luis E">E Luis</name>
</author>
<author><name sortKey="Isabel, S" uniqKey="Isabel S">S Isabel</name>
</author>
<author><name sortKey="Sonia, Z" uniqKey="Sonia Z">Z Sonia</name>
</author>
<author><name sortKey="Fernando, A" uniqKey="Fernando A">A Fernando</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="De Groot, Rj" uniqKey="De Groot R">RJ De Groot</name>
</author>
<author><name sortKey="Baker, Sc" uniqKey="Baker S">SC Baker</name>
</author>
<author><name sortKey="Baric, R" uniqKey="Baric R">R Baric</name>
</author>
<author><name sortKey="Enjuanes, L" uniqKey="Enjuanes L">L Enjuanes</name>
</author>
<author><name sortKey="Gorbalenya, Ae" uniqKey="Gorbalenya A">AE Gorbalenya</name>
</author>
<author><name sortKey="Holmes, Kv" uniqKey="Holmes K">KV Holmes</name>
</author>
<author><name sortKey="Perlman, S" uniqKey="Perlman S">S Perlman</name>
</author>
<author><name sortKey="Poon, L" uniqKey="Poon L">L Poon</name>
</author>
<author><name sortKey="Rottier, Pjm" uniqKey="Rottier P">PJM Rottier</name>
</author>
<author><name sortKey="Talbot, Pj" uniqKey="Talbot P">PJ Talbot</name>
</author>
<author><name sortKey="Woo, Pcy" uniqKey="Woo P">PCY Woo</name>
</author>
<author><name sortKey="Ziebuhr, J" uniqKey="Ziebuhr J">J Ziebuhr</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Lu, R" uniqKey="Lu R">R Lu</name>
</author>
<author><name sortKey="Yu, X" uniqKey="Yu X">X Yu</name>
</author>
<author><name sortKey="Wang, W" uniqKey="Wang W">W Wang</name>
</author>
<author><name sortKey="Duan, X" uniqKey="Duan X">X Duan</name>
</author>
<author><name sortKey="Zhang, L" uniqKey="Zhang L">L Zhang</name>
</author>
<author><name sortKey="Roujian, L" uniqKey="Roujian L">L Roujian</name>
</author>
<author><name sortKey="Xiaoyan, Y" uniqKey="Xiaoyan Y">Y Xiaoyan</name>
</author>
<author><name sortKey="Wen, W" uniqKey="Wen W">W Wen</name>
</author>
<author><name sortKey="Xijie, D" uniqKey="Xijie D">D Xijie</name>
</author>
<author><name sortKey="Linglin, Z" uniqKey="Linglin Z">Z Linglin</name>
</author>
<author><name sortKey="Weimin, Z" uniqKey="Weimin Z">Z Weimin</name>
</author>
<author><name sortKey="Jin, X" uniqKey="Jin X">X Jin</name>
</author>
<author><name sortKey="Lingjie, X" uniqKey="Lingjie X">X Lingjie</name>
</author>
<author><name sortKey="Qin, H" uniqKey="Qin H">H Qin</name>
</author>
<author><name sortKey="Jianxin, L" uniqKey="Jianxin L">L Jianxin</name>
</author>
<author><name sortKey="Li, R" uniqKey="Li R">R Li</name>
</author>
<author><name sortKey="Zhong, W" uniqKey="Zhong W">W Zhong</name>
</author>
<author><name sortKey="Wenjie, T" uniqKey="Wenjie T">T Wenjie</name>
</author>
</analytic>
</biblStruct>
<biblStruct></biblStruct>
<biblStruct><analytic><author><name sortKey="Boheemen, S" uniqKey="Boheemen S">S Boheemen</name>
</author>
<author><name sortKey="Sander, B" uniqKey="Sander B">B Sander</name>
</author>
<author><name sortKey="Miranda, G" uniqKey="Miranda G">G Miranda</name>
</author>
<author><name sortKey="Chris, L" uniqKey="Chris L">L Chris</name>
</author>
<author><name sortKey="Theo, Mb" uniqKey="Theo M">MB Theo</name>
</author>
<author><name sortKey="Stalin, R" uniqKey="Stalin R">R Stalin</name>
</author>
<author><name sortKey="Ali, Mz" uniqKey="Ali M">MZ Ali</name>
</author>
<author><name sortKey="Albert, Dme" uniqKey="Albert D">DME Albert</name>
</author>
<author><name sortKey="Bart, Lh" uniqKey="Bart L">LH Bart</name>
</author>
<author><name sortKey="Osterhaus, Ad" uniqKey="Osterhaus A">AD Osterhaus</name>
</author>
<author><name sortKey="Alexander, Eg" uniqKey="Alexander E">EG Alexander</name>
</author>
<author><name sortKey="Eric, Js" uniqKey="Eric J">JS Eric</name>
</author>
<author><name sortKey="Ron, Amf" uniqKey="Ron A">AMF Ron</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Wever, Ba" uniqKey="Wever B">BA Wever</name>
</author>
<author><name sortKey="Van Der Hoek, L" uniqKey="Van Der Hoek L">L Van der Hoek</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Chan Yeung, M" uniqKey="Chan Yeung M">M Chan-Yeung</name>
</author>
<author><name sortKey="Xu, Rh" uniqKey="Xu R">RH Xu</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Hofmann, H" uniqKey="Hofmann H">H Hofmann</name>
</author>
<author><name sortKey="Pyrc, K" uniqKey="Pyrc K">K Pyrc</name>
</author>
<author><name sortKey="Van Der Hoek, L" uniqKey="Van Der Hoek L">L Van der Hoek</name>
</author>
<author><name sortKey="Geier, M" uniqKey="Geier M">M Geier</name>
</author>
<author><name sortKey="Ben, B" uniqKey="Ben B">B Ben</name>
</author>
<author><name sortKey="Stefan, P" uniqKey="Stefan P">P Stefan</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Ali Mohamed, Z" uniqKey="Ali Mohamed Z">Z Ali Mohamed</name>
</author>
<author><name sortKey="Van Boheemen, S" uniqKey="Van Boheemen S">S Van Boheemen</name>
</author>
<author><name sortKey="Bestebroer, Tm" uniqKey="Bestebroer T">TM Bestebroer</name>
</author>
<author><name sortKey="Albert, Dme" uniqKey="Albert D">DME Albert</name>
</author>
<author><name sortKey="Osterhaus, Ad" uniqKey="Osterhaus A">AD Osterhaus</name>
</author>
<author><name sortKey="Ron, Am" uniqKey="Ron A">AM Ron</name>
</author>
<author><name sortKey="Fouchier, Ra" uniqKey="Fouchier R">RA Fouchier</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="S Rensen, Md" uniqKey="S Rensen M">MD Sørensen</name>
</author>
<author><name sortKey="S Rensen, B" uniqKey="S Rensen B">B Sørensen</name>
</author>
<author><name sortKey="Gonzalez Dosal, R" uniqKey="Gonzalez Dosal R">R Gonzalez-Dosal</name>
</author>
<author><name sortKey="Melchjorsen, Cj" uniqKey="Melchjorsen C">CJ Melchjorsen</name>
</author>
<author><name sortKey="Weibel, J" uniqKey="Weibel J">J Weibel</name>
</author>
<author><name sortKey="Wang, J" uniqKey="Wang J">J Wang</name>
</author>
<author><name sortKey="Jun, Cw" uniqKey="Jun C">CW Jun</name>
</author>
<author><name sortKey="Huanming, Y" uniqKey="Huanming Y">Y Huanming</name>
</author>
<author><name sortKey="Kristensen, P" uniqKey="Kristensen P">P Kristensen</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Cheng, Vc" uniqKey="Cheng V">VC Cheng</name>
</author>
<author><name sortKey="Lau, Sk" uniqKey="Lau S">SK Lau</name>
</author>
<author><name sortKey="Woo, Pc" uniqKey="Woo P">PC Woo</name>
</author>
<author><name sortKey="Yuen, Ky" uniqKey="Yuen K">KY Yuen</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Pierre, S" uniqKey="Pierre S">S Pierre</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Robert, R" uniqKey="Robert R">R Robert</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Helen, B" uniqKey="Helen B">B Helen</name>
</author>
</analytic>
</biblStruct>
<biblStruct></biblStruct>
<biblStruct><analytic><author><name sortKey="Falzarano, D" uniqKey="Falzarano D">D Falzarano</name>
</author>
<author><name sortKey="Darryl, F" uniqKey="Darryl F">F Darryl</name>
</author>
<author><name sortKey="De Emmie, W" uniqKey="De Emmie W">W De Emmie</name>
</author>
<author><name sortKey="Cynthia, M" uniqKey="Cynthia M">M Cynthia</name>
</author>
<author><name sortKey="Julie, C" uniqKey="Julie C">C Julie</name>
</author>
<author><name sortKey="Vincent, J" uniqKey="Vincent J">J Vincent</name>
</author>
<author><name sortKey="Heinz, F" uniqKey="Heinz F">F Heinz</name>
</author>
<author><name sortKey="Munster, Vj" uniqKey="Munster V">VJ Munster</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Wong, Ss" uniqKey="Wong S">SS Wong</name>
</author>
<author><name sortKey="Yuen, Ky" uniqKey="Yuen K">KY Yuen</name>
</author>
</analytic>
</biblStruct>
<biblStruct></biblStruct>
<biblStruct><analytic><author><name sortKey="Xianfu, W" uniqKey="Xianfu W">W Xianfu</name>
</author>
<author><name sortKey="Smith, Tg" uniqKey="Smith T">TG Smith</name>
</author>
<author><name sortKey="Rupprecht, Ce" uniqKey="Rupprecht C">CE Rupprecht</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Plotkin, Sa" uniqKey="Plotkin S">SA Plotkin</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Matthew, C" uniqKey="Matthew C">C Matthew</name>
</author>
<author><name sortKey="Lam, Tt" uniqKey="Lam T">TT Lam</name>
</author>
<author><name sortKey="Watson, Sj" uniqKey="Watson S">SJ Watson</name>
</author>
<author><name sortKey="Annie, Lp" uniqKey="Annie L">LP Annie</name>
</author>
<author><name sortKey="Velilava, P" uniqKey="Velilava P">P Velilava</name>
</author>
<author><name sortKey="Paul, G" uniqKey="Paul G">G Paul</name>
</author>
<author><name sortKey="Oliver, Gp" uniqKey="Oliver G">GP Oliver</name>
</author>
<author><name sortKey="Andrew, R" uniqKey="Andrew R">R Andrew</name>
</author>
<author><name sortKey="Yi, G" uniqKey="Yi G">G Yi</name>
</author>
<author><name sortKey="Deenan, P" uniqKey="Deenan P">P Deenan</name>
</author>
<author><name sortKey="Paul, K" uniqKey="Paul K">K Paul</name>
</author>
<author><name sortKey="Eleni, K" uniqKey="Eleni K">K Eleni</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Islam, R" uniqKey="Islam R">R Islam</name>
</author>
<author><name sortKey="Sadman, S" uniqKey="Sadman S">S Sadman</name>
</author>
<author><name sortKey="Aubhishek, Z" uniqKey="Aubhishek Z">Z Aubhishek</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Thompson, Jd" uniqKey="Thompson J">JD Thompson</name>
</author>
<author><name sortKey="Higgins, Dg" uniqKey="Higgins D">DG Higgins</name>
</author>
<author><name sortKey="Gibson, Tj" uniqKey="Gibson T">TJ Gibson</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Garcia Boronat, M" uniqKey="Garcia Boronat M">M Garcia-Boronat</name>
</author>
<author><name sortKey="Diez Rivero, Cm" uniqKey="Diez Rivero C">CM Diez-Rivero</name>
</author>
<author><name sortKey="Reinherz, El" uniqKey="Reinherz E">EL Reinherz</name>
</author>
<author><name sortKey="Pedro, Ar" uniqKey="Pedro A">AR Pedro</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Waterhouse, Am" uniqKey="Waterhouse A">AM Waterhouse</name>
</author>
<author><name sortKey="Procter, Jb" uniqKey="Procter J">JB Procter</name>
</author>
<author><name sortKey="Martin, Dm" uniqKey="Martin D">DM Martin</name>
</author>
<author><name sortKey="Clamp, M" uniqKey="Clamp M">M Clamp</name>
</author>
<author><name sortKey="Barton, Gj" uniqKey="Barton G">GJ Barton</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Caoili, Sec" uniqKey="Caoili S">SEC Caoili</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Kolaskar, A" uniqKey="Kolaskar A">A Kolaskar</name>
</author>
<author><name sortKey="Tongaonkar, Pc" uniqKey="Tongaonkar P">PC Tongaonkar</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Vita, R" uniqKey="Vita R">R Vita</name>
</author>
<author><name sortKey="Zarebski, L" uniqKey="Zarebski L">L Zarebski</name>
</author>
<author><name sortKey="Greenbaum, Ja" uniqKey="Greenbaum J">JA Greenbaum</name>
</author>
<author><name sortKey="Emami, H" uniqKey="Emami H">H Emami</name>
</author>
<author><name sortKey="Hoof, I" uniqKey="Hoof I">I Hoof</name>
</author>
<author><name sortKey="Salimi, N" uniqKey="Salimi N">N Salimi</name>
</author>
<author><name sortKey="Damle, R" uniqKey="Damle R">R Damle</name>
</author>
<author><name sortKey="Sette, A" uniqKey="Sette A">A Sette</name>
</author>
<author><name sortKey="Peters, B" uniqKey="Peters B">B Peters</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Jens Erik, Pl" uniqKey="Jens Erik P">PL Jens Erik</name>
</author>
<author><name sortKey="Pontoppidan, L" uniqKey="Pontoppidan L">L Pontoppidan</name>
</author>
<author><name sortKey="Ole, L" uniqKey="Ole L">L Ole</name>
</author>
<author><name sortKey="Morten, N" uniqKey="Morten N">N Morten</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Emini, Ea" uniqKey="Emini E">EA Emini</name>
</author>
<author><name sortKey="Hughes, Jv" uniqKey="Hughes J">JV Hughes</name>
</author>
<author><name sortKey="Perlow, Ds" uniqKey="Perlow D">DS Perlow</name>
</author>
<author><name sortKey="Boger, J" uniqKey="Boger J">J Boger</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Bui, Hh" uniqKey="Bui H">HH Bui</name>
</author>
<author><name sortKey="Sidney, J" uniqKey="Sidney J">J Sidney</name>
</author>
<author><name sortKey="Li, W" uniqKey="Li W">W Li</name>
</author>
<author><name sortKey="Fusseder, N" uniqKey="Fusseder N">N Fusseder</name>
</author>
<author><name sortKey="Sette, A" uniqKey="Sette A">A Sette</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Parker, Jm" uniqKey="Parker J">JM Parker</name>
</author>
<author><name sortKey="Guo, D" uniqKey="Guo D">D Guo</name>
</author>
<author><name sortKey="Hodges, Rs" uniqKey="Hodges R">RS Hodges</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Zhang, Y" uniqKey="Zhang Y">Y Zhang</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Laskowski, Ra" uniqKey="Laskowski R">RA Laskowski</name>
</author>
<author><name sortKey="Macarthur, Mw" uniqKey="Macarthur M">MW MacArthur</name>
</author>
<author><name sortKey="Moss, Ds" uniqKey="Moss D">DS Moss</name>
</author>
<author><name sortKey="Thornton, Jm" uniqKey="Thornton J">JM Thornton</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Pettersen, Ef" uniqKey="Pettersen E">EF Pettersen</name>
</author>
<author><name sortKey="Goddard, Td" uniqKey="Goddard T">TD Goddard</name>
</author>
<author><name sortKey="Huang, Cc" uniqKey="Huang C">CC Huang</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="To, Kkw" uniqKey="To K">KKW To</name>
</author>
<author><name sortKey="Hung, Ifn" uniqKey="Hung I">IFN Hung</name>
</author>
<author><name sortKey="Chan, Jfw" uniqKey="Chan J">JFW Chan</name>
</author>
<author><name sortKey="Yuen, Ky" uniqKey="Yuen K">KY Yuen</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Muller, Ma" uniqKey="Muller M">MA Muller</name>
</author>
<author><name sortKey="Muller, Ma" uniqKey="Muller M">MA Muller</name>
</author>
<author><name sortKey="Stalin, Rv" uniqKey="Stalin R">RV Stalin</name>
</author>
<author><name sortKey="Doreen, M" uniqKey="Doreen M">M Doreen</name>
</author>
<author><name sortKey="Benjamin, M" uniqKey="Benjamin M">M Benjamin</name>
</author>
<author><name sortKey="Stephan, K" uniqKey="Stephan K">K Stephan</name>
</author>
<author><name sortKey="Saskia, L" uniqKey="Saskia L">L Saskia</name>
</author>
<author><name sortKey="Robert, W" uniqKey="Robert W">W Robert</name>
</author>
<author><name sortKey="Sabine, S" uniqKey="Sabine S">S Sabine</name>
</author>
<author><name sortKey="Tasnim, S" uniqKey="Tasnim S">S Tasnim</name>
</author>
<author><name sortKey="Katrin, Z" uniqKey="Katrin Z">Z Katrin</name>
</author>
<author><name sortKey="Tabea, B" uniqKey="Tabea B">B Tabea</name>
</author>
<author><name sortKey="Isabella, E" uniqKey="Isabella E">E Isabella</name>
</author>
<author><name sortKey="Marco, T" uniqKey="Marco T">T Marco</name>
</author>
<author><name sortKey="Ali, Mz" uniqKey="Ali M">MZ Ali</name>
</author>
<author><name sortKey="Albert, Dme" uniqKey="Albert D">DME Albert</name>
</author>
<author><name sortKey="Ron, Am" uniqKey="Ron A">AM Ron</name>
</author>
<author><name sortKey="Bart, Lh" uniqKey="Bart L">LH Bart</name>
</author>
<author><name sortKey="Christian, D" uniqKey="Christian D">D Christian</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Yang, Zy" uniqKey="Yang Z">ZY Yang</name>
</author>
<author><name sortKey="Kong, Wp" uniqKey="Kong W">WP Kong</name>
</author>
<author><name sortKey="Huang, Y" uniqKey="Huang Y">Y Huang</name>
</author>
<author><name sortKey="Roberts, A" uniqKey="Roberts A">A Roberts</name>
</author>
<author><name sortKey="Murphy, Br" uniqKey="Murphy B">BR Murphy</name>
</author>
<author><name sortKey="Subbarao, K" uniqKey="Subbarao K">K Subbarao</name>
</author>
<author><name sortKey="Nabel, Gj" uniqKey="Nabel G">GJ Nabel</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Sudhakar, A" uniqKey="Sudhakar A">A Sudhakar</name>
</author>
<author><name sortKey="Robin, G" uniqKey="Robin G">G Robin</name>
</author>
<author><name sortKey="Boyd, L" uniqKey="Boyd L">L Boyd</name>
</author>
<author><name sortKey="Agnihothram, S" uniqKey="Agnihothram S">S Agnihothram</name>
</author>
<author><name sortKey="Gopal, R" uniqKey="Gopal R">R Gopal</name>
</author>
<author><name sortKey="Yount, Bl" uniqKey="Yount B">BL Yount</name>
</author>
<author><name sortKey="Donaldson, Ef" uniqKey="Donaldson E">EF Donaldson</name>
</author>
<author><name sortKey="Menachery, Vd" uniqKey="Menachery V">VD Menachery</name>
</author>
<author><name sortKey="Graham, Rl" uniqKey="Graham R">RL Graham</name>
</author>
<author><name sortKey="Scobey, Td" uniqKey="Scobey T">TD Scobey</name>
</author>
<author><name sortKey="Gralinski, Le" uniqKey="Gralinski L">LE Gralinski</name>
</author>
<author><name sortKey="Denison, Mr" uniqKey="Denison M">MR Denison</name>
</author>
<author><name sortKey="Zambon, M" uniqKey="Zambon M">M Zambon</name>
</author>
<author><name sortKey="Baric, R" uniqKey="Baric R">R Baric</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Fernando, A" uniqKey="Fernando A">A Fernando</name>
</author>
<author><name sortKey="Marta, L" uniqKey="Marta L">L Marta</name>
</author>
<author><name sortKey="Isabel, S" uniqKey="Isabel S">S Isabel</name>
</author>
<author><name sortKey="Sonia, Z" uniqKey="Sonia Z">Z Sonia</name>
</author>
<author><name sortKey="Jose, L" uniqKey="Jose L">L Jose</name>
</author>
<author><name sortKey="Silvia, Lj" uniqKey="Silvia L">LJ Silvia</name>
</author>
<author><name sortKey="German, A" uniqKey="German A">A German</name>
</author>
<author><name sortKey="Luis, E" uniqKey="Luis E">E Luis</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Pica, N" uniqKey="Pica N">N Pica</name>
</author>
<author><name sortKey="Palese, P" uniqKey="Palese P">P Palese</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Elaine, Vj" uniqKey="Elaine V">VJ Elaine</name>
</author>
<author><name sortKey="Sharon, K" uniqKey="Sharon K">K Sharon</name>
</author>
<author><name sortKey="Timothy, Jm" uniqKey="Timothy J">JM Timothy</name>
</author>
<author><name sortKey="Albert, Pr" uniqKey="Albert P">PR Albert</name>
</author>
<author><name sortKey="Smithkline, Bc" uniqKey="Smithkline B">BC Smithkline</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Arnon, R" uniqKey="Arnon R">R Arnon</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Olesen, Of" uniqKey="Olesen O">OF Olesen</name>
</author>
<author><name sortKey="Lonnoroth, A" uniqKey="Lonnoroth A">A Lonnoroth</name>
</author>
<author><name sortKey="Mulligan, B" uniqKey="Mulligan B">B Mulligan</name>
</author>
</analytic>
</biblStruct>
<biblStruct><analytic><author><name sortKey="Benson, Da" uniqKey="Benson D">DA Benson</name>
</author>
<author><name sortKey="Cavanaugh, M" uniqKey="Cavanaugh M">M Cavanaugh</name>
</author>
<author><name sortKey="Clark, K" uniqKey="Clark K">K Clark</name>
</author>
<author><name sortKey="Karsch Mizrachi, I" uniqKey="Karsch Mizrachi I">I Karsch-Mizrachi</name>
</author>
<author><name sortKey="Lipman, Dj" uniqKey="Lipman D">DJ Lipman</name>
</author>
<author><name sortKey="Ostell, J" uniqKey="Ostell J">J Ostell</name>
</author>
<author><name sortKey="Sayers, Ew" uniqKey="Sayers E">EW Sayers</name>
</author>
</analytic>
</biblStruct>
</listBibl>
</div1>
</back>
</TEI>
<pmc article-type="research-article" xml:lang="en"><pmc-dir>properties open_access</pmc-dir>
<front><journal-meta><journal-id journal-id-type="nlm-ta">BMC Bioinformatics</journal-id>
<journal-id journal-id-type="iso-abbrev">BMC Bioinformatics</journal-id>
<journal-title-group><journal-title>BMC Bioinformatics</journal-title>
</journal-title-group>
<issn pub-type="epub">1471-2105</issn>
<publisher><publisher-name>BioMed Central</publisher-name>
</publisher>
</journal-meta>
<article-meta><article-id pub-id-type="pmid">24884408</article-id>
<article-id pub-id-type="pmc">4041900</article-id>
<article-id pub-id-type="publisher-id">1471-2105-15-161</article-id>
<article-id pub-id-type="doi">10.1186/1471-2105-15-161</article-id>
<article-categories><subj-group subj-group-type="heading"><subject>Research Article</subject>
</subj-group>
</article-categories>
<title-group><article-title>A highly conserved WDYPKCDRA epitope in the RNA directed RNA polymerase of human coronaviruses can be used as epitope-based universal vaccine design</article-title>
</title-group>
<contrib-group><contrib contrib-type="author" id="A1"><name><surname>Sharmin</surname>
<given-names>Refat</given-names>
</name>
<xref ref-type="aff" rid="I1">1</xref>
<email>refat519@gmail.com</email>
</contrib>
<contrib contrib-type="author" corresp="yes" id="A2"><name><surname>Islam</surname>
<given-names>Abul Bashar Mir Md Khademul</given-names>
</name>
<xref ref-type="aff" rid="I1">1</xref>
<email>khademul@du.ac.bd</email>
</contrib>
</contrib-group>
<aff id="I1"><label>1</label>
Department of Genetic Engineering and Biotechnology, University of Dhaka, Science Complex Building, Dhaka 1000, Bangladesh</aff>
<pub-date pub-type="collection"><year>2014</year>
</pub-date>
<pub-date pub-type="epub"><day>29</day>
<month>5</month>
<year>2014</year>
</pub-date>
<volume>15</volume>
<fpage>161</fpage>
<lpage>161</lpage>
<history><date date-type="received"><day>12</day>
<month>2</month>
<year>2014</year>
</date>
<date date-type="accepted"><day>19</day>
<month>5</month>
<year>2014</year>
</date>
</history>
<permissions><copyright-statement>Copyright © 2014 Sharmin and Islam; licensee BioMed Central Ltd.</copyright-statement>
<copyright-year>2014</copyright-year>
<copyright-holder>Sharmin and Islam; licensee BioMed Central Ltd.</copyright-holder>
<license license-type="open-access" xlink:href="http://creativecommons.org/licenses/by/4.0"><license-p>This is an Open Access article distributed under the terms of the Creative Commons Attribution License (<ext-link ext-link-type="uri" xlink:href="http://creativecommons.org/licenses/by/4.0">http://creativecommons.org/licenses/by/4.0</ext-link>
), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (<ext-link ext-link-type="uri" xlink:href="http://creativecommons.org/publicdomain/zero/1.0/">http://creativecommons.org/publicdomain/zero/1.0/</ext-link>
) applies to the data made available in this article, unless otherwise stated.</license-p>
</license>
</permissions>
<self-uri xlink:href="http://www.biomedcentral.com/1471-2105/15/161"></self-uri>
<abstract><sec><title>Background</title>
<p>Coronaviruses are the diverse group of RNA virus. From 1960, six strains of human coronaviruses have emerged that includes SARS-CoV and the recent infection by deadly MERS-CoV which is now going to cause another outbreak. Prevention of these viruses is urgent and a universal vaccine for all strain could be a promising solution in this circumstance. In this study we aimed to design an epitope based vaccine against all strain of human coronavirus.</p>
</sec>
<sec><title>Results</title>
<p>Multiple sequence alignment (MSA) approach was employed among spike (S), membrane (M), enveloped (E) and nucleocapsid (N) protein and replicase polyprotein 1ab to identify which one is highly conserve in all coronaviruses strains. Next, we use various <italic>in silico</italic>
tools to predict consensus immunogenic and conserved peptide. We found that conserved region is present only in the RNA directed RNA polymerase protein. In this protein we identified one epitope WDYPKCDRA is highly immunogenic and 100% conserved among all available human coronavirus strains.</p>
</sec>
<sec><title>Conclusions</title>
<p>Here we suggest <italic>in vivo</italic>
study of our identified novel peptide antigen in RNA directed RNA polymerase protein for universal vaccine – which may be the way to prevent all human coronavirus disease.</p>
</sec>
</abstract>
<kwd-group><kwd>Coronavirus</kwd>
<kwd>SARS-CoV</kwd>
<kwd>MERS-CoV</kwd>
<kwd>RNA directed RNA polymerase</kwd>
<kwd>Epitope</kwd>
<kwd>Universal vaccine</kwd>
</kwd-group>
</article-meta>
</front>
<body><sec><title>Background</title>
<p>Coronaviruses are the diverse group of virus which infects domestic animals, birds as well as human [<xref ref-type="bibr" rid="B1">1</xref>
]. Coronaviruses are enveloped viruses which are the members of Coronaviridae family [<xref ref-type="bibr" rid="B2">2</xref>
]. Coronaviruses have positive strand RNA genome which is approximately 26–32 kb long. The overall structures of all coronaviruses are composed of the spike (S), envelope (E), membrane (M) and nucleocapsid (N) protein. The other non-structural proteins like RNA directed RNA polymerase, helicase, 3CL like proteinases etc are produced by the cleavage of replicase polyprotein 1ab or ORF 1ab polyprotein [<xref ref-type="bibr" rid="B3">3</xref>
].</p>
<p>The first coronavirus 229E was identified in 1960. Since then different types of coronaviruses have emerged. HCoV-229E, HCoV-OC43, SARS-CoV, HCoV-NL63, HCoV-HKU1 and MERS-CoV are the coronaviruses which infect human [<xref ref-type="bibr" rid="B4">4</xref>
]. Most of the coronaviruses cause respiratory, enteric, hepatic, or neurological diseases with highly variable severity in their hosts [<xref ref-type="bibr" rid="B5">5</xref>
]. The first two coronavirus HCoV-229E and HCoV-OC43 infects lower respiratory tract where the later SARS-CoV, HCoV-NL63, HCoV-HKU1 infect both lower and upper respiratory tract [<xref ref-type="bibr" rid="B4">4</xref>
,<xref ref-type="bibr" rid="B6">6</xref>
-<xref ref-type="bibr" rid="B8">8</xref>
]. But the newly emerged MERS-CoV infects both lung and kidney that reflects how these viruses are changing their cell tropism and becoming highly pathogenic [<xref ref-type="bibr" rid="B9">9</xref>
].</p>
<p>Most infections caused by human coronaviruses were relatively mild. Among all the human coronaviruses, SARS-CoV and MERS-CoV are much more deadly. The severe acute respiratory syndrome (SARS) outbreak caused by SARS-CoV in 2002 to 2003. The SARS-CoV created outbreak resulted in a total of 916 deaths among more than 8000 confirmed cases in over 30 countries [<xref ref-type="bibr" rid="B10">10</xref>
,<xref ref-type="bibr" rid="B11">11</xref>
]. The newly emerged MERS-CoV is now posing a great threat for human. According to WHO, 75 people have died among more than 178 confirmed cases caused by MERS-CoV [<xref ref-type="bibr" rid="B4">4</xref>
]. Though this MERS-CoV virus was first found in Saudi Arabia 2012, now it has been emerged in UK, France, Tunisia, Spain and Italy that indicates it’s going to create another outbreak like SARS-CoV [<xref ref-type="bibr" rid="B12">12</xref>
-<xref ref-type="bibr" rid="B14">14</xref>
]. From 1960 to till now there is no recommended drug or vaccine for MERS-CoV infection and treatment relies on exclusively supportive care, which gives the high case-fatality rate, is not highly effective [<xref ref-type="bibr" rid="B15">15</xref>
].</p>
<p>In 2003 after the discovery of SARS-CoV, there were a significant increase in research on coronavirus, but no definitive antiviral or therapeutic treatment for coronavirus infections came from these researches [<xref ref-type="bibr" rid="B16">16</xref>
]. From the clinical experience of SARS-CoV found that a number of interventions including ribavirin with and without corticosteroids, ribavirin with protease inhibitors and interferon with corticosteroids may improve outcome. But a definitive treatment was not clearly established and the therapeutic interventions have not been evaluated <italic>in vivo</italic>
[<xref ref-type="bibr" rid="B17">17</xref>
].</p>
<p>The identification of therapeutics is a high priority and though there is currently no specific therapy or vaccine for human coronaviruses, this disease has been severe with a high case-fatality rate [<xref ref-type="bibr" rid="B18">18</xref>
]. As these viruses are now becoming pathogenic and causing outbreaks, so steps have to be taken to prevent human death. Vaccination is one of the most efficient ways to prevent infectious disease [<xref ref-type="bibr" rid="B19">19</xref>
]. Effective vaccines controlling virus spread and disease are available for a number of infections, such as smallpox, poliomyelitis, measles, mumps, rubella, influenza, hepatitis A, and hepatitis B [<xref ref-type="bibr" rid="B20">20</xref>
]. For coronavirus, this vaccine approach is hindered by the fact that human coronavirus strains are not structurally related and they are changing rapidly by recombination [<xref ref-type="bibr" rid="B21">21</xref>
]. Therefore, designing a universal vaccine against conserved regions for all human coronaviruses is a major challenge at present.</p>
<p>With the disclosure of huge sequence information, epitope based vaccine design now has become a most promising approach for viral vaccine preparation [<xref ref-type="bibr" rid="B22">22</xref>
]. In order to prepare vaccines, computational prediction of epitopes and vaccine design can reliably aid this process to reduce time and cost. Although the epitope based vaccine design is now a familiar concept, not much work has been done in case of coronaviruses.</p>
<p>In this study, we design an epitope based universal vaccine which can be use to prevent all kind of human coronaviruses. For this, bioinformatics analyses of viral proteins were done for finding the conserved peptide region and for mapping the evolutionary conserved epitope. The 3D structure of RNA directed RNA polymerase was determined by threading modeling technique and a highly immunogenic, accessible and conserved epitope was identified. This epitope can be used as a universal vaccine against all human coronaviruses.</p>
</sec>
<sec sec-type="results"><title>Results</title>
<sec><title>RNA directed RNA polymerase is highly conserved in all human coronavirus strains</title>
<p>To find a conserved region, MSA by clustalW [<xref ref-type="bibr" rid="B23">23</xref>
] and protein variability index [<xref ref-type="bibr" rid="B24">24</xref>
] analyses were performed. No conserved region was found in case of S, E, M and N proteins (Additional file <xref ref-type="supplementary-material" rid="S1">1</xref>
: Figure S1, Additional file <xref ref-type="supplementary-material" rid="S2">2</xref>
: Figure S2, Additional file <xref ref-type="supplementary-material" rid="S3">3</xref>
: Figure S3, Additional file <xref ref-type="supplementary-material" rid="S4">4</xref>
: Figure S4 respectively). From the MSA of replicase polyprotein 1ab coronaviruses were found to be conserved in RNA directed RNA polymerase (Additional file <xref ref-type="supplementary-material" rid="S5">5</xref>
: Figure S5). MSA of this RNA directed RNA polymerase region (Figure <xref ref-type="fig" rid="F1">1</xref>
) and protein variability index (Figure <xref ref-type="fig" rid="F2">2</xref>
) identified a 385 amino acid long conserved region among all human coronaviruses. The conserve sequence was then used to determine immunogenicity.</p>
<fig id="F1" position="float"><label>Figure 1</label>
<caption><p><bold>Conserved peptide in RNA directed RNA polymerase.</bold>
Multiple sequence alignment of the 46 replicase polyprotein 1ab of all coronaviruses revealed that human coronaviruses are conserved in RNA directed RNA polymerase. This alignment was visualized by Jalview 2.8 [<xref ref-type="bibr" rid="B25">25</xref>
]. Along the alignment this tool provides a graphical (bar chart) conservation summery using 11-base scale for conservancy and BLOSUM 62 for quality. For Conservation yellow color bar and star sign indicates the full conservation. Black bars showed the consensus sequence and yellow color indicates good quality. All the colors changes according to the conservation and alignment quality.</p>
</caption>
<graphic xlink:href="1471-2105-15-161-1"></graphic>
</fig>
<fig id="F2" position="float"><label>Figure 2</label>
<caption><p><bold>Protein variability index of the conserved peptide.</bold>
The protein variability index of the conserved peptide was determined by using PVS server [<xref ref-type="bibr" rid="B24">24</xref>
]. The conservancy threshold was 1.0 in this analysis. X axis indicates the amino acid position in sequences and Y axis indicates the Wu-kabat variability.</p>
</caption>
<graphic xlink:href="1471-2105-15-161-2"></graphic>
</fig>
</sec>
<sec><title>Both YPKCDRA and YYVKPG identified as consensus and highly immunogenic epitopes by two different algorithms</title>
<p>For vaccine design the peptide has to be immunogenic and antigenic [<xref ref-type="bibr" rid="B26">26</xref>
]. The conserved peptide was found to be highly antigenic (Figure <xref ref-type="fig" rid="F3">3</xref>
) in IEDB epitope prediction analysis [<xref ref-type="bibr" rid="B27">27</xref>
]. In this analysis 1.000 threshold was used and most of the residues in the peptides were found above the threshold level. B-cell epitopes were predicted using Immune Epitope Database (IEDB) [<xref ref-type="bibr" rid="B28">28</xref>
] B-cell epitope prediction tool and Bepipred [<xref ref-type="bibr" rid="B29">29</xref>
] using the conserved protein sequence. Several epitopes were predicted (Table <xref ref-type="table" rid="T1">1</xref>
) by these algorithms, but only those epitopes sequences that are found full or at least 90% overlap between IEDB B-cell epitope prediction tool [<xref ref-type="bibr" rid="B28">28</xref>
] and Bepipred prediction [<xref ref-type="bibr" rid="B29">29</xref>
] are chosen as desired epitopes (Table <xref ref-type="table" rid="T2">2</xref>
). YPKCDRA and YYVKPG epitopes were found to be consensus among both tools predicted epitopes.</p>
<fig id="F3" position="float"><label>Figure 3</label>
<caption><p><bold>Antigenicity of the conserved peptide.</bold>
The conserved peptide was found to be highly antigenic in the IEDB analysis [<xref ref-type="bibr" rid="B27">27</xref>
]. Most of the residues were found above the threshold 1.00. Residues in the yellow region are antigenic and in the green region are below the threshold (red line).</p>
</caption>
<graphic xlink:href="1471-2105-15-161-3"></graphic>
</fig>
<table-wrap position="float" id="T1"><label>Table 1</label>
<caption><p><bold>Predicted antigenic sites and their lengths using Bepipred </bold>
[<xref ref-type="bibr" rid="B29">29</xref>
]<bold>and IEDB </bold>
[<xref ref-type="bibr" rid="B28">28</xref>
]<bold>analysis tools</bold>
</p>
</caption>
<table frame="hsides" rules="groups" border="1"><colgroup><col align="center"></col>
<col align="center"></col>
<col align="center"></col>
<col align="center"></col>
</colgroup>
<thead valign="top"><tr><th colspan="2" align="center" valign="bottom"><bold>Bepipred analysis</bold>
<hr></hr>
</th>
<th colspan="2" align="center" valign="bottom"><bold>IEDB analysis</bold>
<hr></hr>
</th>
</tr>
<tr><th align="left"><bold>Peptide</bold>
</th>
<th align="center"><bold>Length (aa)</bold>
</th>
<th align="left"><bold>Peptide</bold>
</th>
<th align="center"><bold>Length (aa)</bold>
</th>
</tr>
</thead>
<tbody valign="top"><tr><td align="center" valign="bottom">VRPGNFNQ<hr></hr>
</td>
<td align="center" valign="bottom">8<hr></hr>
</td>
<td align="center" valign="bottom">DYKVQLFEKYFKY<hr></hr>
</td>
<td align="center" valign="bottom">13<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">GNAAIT<hr></hr>
</td>
<td align="center" valign="bottom">6<hr></hr>
</td>
<td align="center" valign="bottom">HANCVNCTDDRCVLHCANFNVLFAM<hr></hr>
</td>
<td align="center" valign="bottom">25<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DKSAGHPFN<hr></hr>
</td>
<td align="center" valign="bottom">9<hr></hr>
</td>
<td align="center" valign="bottom">KTCFGPIVRKIFVDGVPFVVSCGYHYKELGLV<hr></hr>
</td>
<td align="center" valign="bottom">32<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">SYQEQ<hr></hr>
</td>
<td align="center" valign="bottom">5<hr></hr>
</td>
<td align="center" valign="bottom">VSLHRHRLSLK<hr></hr>
</td>
<td align="center" valign="bottom">11<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DVDNP<hr></hr>
</td>
<td align="center" valign="bottom">5<hr></hr>
</td>
<td align="center" valign="bottom">ADPAMHI<hr></hr>
</td>
<td align="center" valign="bottom">7<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YPKCDRA<hr></hr>
</td>
<td align="center" valign="bottom">7<hr></hr>
</td>
<td align="center" valign="bottom">SSNAFLDLRTSCFSVAALTTG<hr></hr>
</td>
<td align="center" valign="bottom">21<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YYVKPGGTSSGDATTAY<hr></hr>
</td>
<td align="center" valign="bottom">17<hr></hr>
</td>
<td align="center" valign="bottom">YDFVVSKG<hr></hr>
</td>
<td align="center" valign="bottom">8<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">SVTLKHFFFA<hr></hr>
</td>
<td align="center" valign="bottom">10<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">DYNYYSYN<hr></hr>
</td>
<td align="center" valign="bottom">8<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">PTMCDIKQMLFCMEVVNKYFEI<hr></hr>
</td>
<td align="center" valign="bottom">22<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">DGGCLNASEVVVNN<hr></hr>
</td>
<td align="center" valign="bottom">14<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">KARVYYESM<hr></hr>
</td>
<td align="center" valign="bottom">9<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">LKYAIS<hr></hr>
</td>
<td align="center" valign="bottom">6<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">TVAGVSILS<hr></hr>
</td>
<td align="center" valign="bottom">9<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">GATCVIGTT<hr></hr>
</td>
<td align="center" valign="bottom">9<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">LKTLYKDV<hr></hr>
</td>
<td align="center" valign="bottom">8<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">YPKCDRA<hr></hr>
</td>
<td align="center" valign="bottom">7<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">CRIFASLILARKHGTCCTT<hr></hr>
</td>
<td align="center" valign="bottom">19<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">YRLANECAQVLSEYVLCGGGYYVKPG<hr></hr>
</td>
<td align="center" valign="bottom">26<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom"> <hr></hr>
</td>
<td align="center" valign="bottom">ANSVFNILQA<hr></hr>
</td>
<td align="center" valign="bottom">10<hr></hr>
</td>
</tr>
<tr><td align="center"> </td>
<td align="center"> </td>
<td align="center">TANVSAL</td>
<td align="center">7</td>
</tr>
</tbody>
</table>
</table-wrap>
<table-wrap position="float" id="T2"><label>Table 2</label>
<caption><p><bold>Consensus antigenic sites between Bepipred </bold>
[<xref ref-type="bibr" rid="B29">29</xref>
]<bold>and IEDB analysis </bold>
[<xref ref-type="bibr" rid="B28">28</xref>
]<bold>predicted antigenic sites</bold>
</p>
</caption>
<table frame="hsides" rules="groups" border="1"><colgroup><col align="left"></col>
<col align="left"></col>
</colgroup>
<thead valign="top"><tr><th align="left"><bold>Consensus Epitope</bold>
</th>
<th align="left"><bold>Length (aa)</bold>
</th>
</tr>
</thead>
<tbody valign="top"><tr><td align="left" valign="bottom">YPKCDRA<hr></hr>
</td>
<td align="left" valign="bottom">7<hr></hr>
</td>
</tr>
<tr><td align="left">YYVKPG</td>
<td align="left">6</td>
</tr>
</tbody>
</table>
</table-wrap>
</sec>
<sec><title>Nine surface accessible epitopes were predicted from the conserved peptide</title>
<p>To become a vaccine, an epitope should be accessible to the antibody. If the antibody can bind to the epitope that will be able to induce an immune response [<xref ref-type="bibr" rid="B26">26</xref>
]. The surface accessibility of the conserved peptide (Figure <xref ref-type="fig" rid="F4">4</xref>
) was determined using 1.000 threshold level and nine accessible epitopes were found to be above the threshold level (Figure <xref ref-type="fig" rid="F4">4</xref>
) (Table <xref ref-type="table" rid="T3">3</xref>
) using Immune Epitope Database (IEDB) [<xref ref-type="bibr" rid="B28">28</xref>
] Emini surface accessibility prediction analysis [<xref ref-type="bibr" rid="B30">30</xref>
]. Among these nine epitopes, WDYPKC epitope overlaps with the Bepipred [<xref ref-type="bibr" rid="B29">29</xref>
] and IEDB [<xref ref-type="bibr" rid="B28">28</xref>
] predicted consensus epitope YPKCDRA.</p>
<fig id="F4" position="float"><label>Figure 4</label>
<caption><p><bold>Conserved peptide’s surface accessibility.</bold>
The surface accessible residues of the conserved peptide which are above the cut off are located in the yellow region. The red horizontal line indicates surface accessibility cutoff (1.000).</p>
</caption>
<graphic xlink:href="1471-2105-15-161-4"></graphic>
</fig>
<table-wrap position="float" id="T3"><label>Table 3</label>
<caption><p><bold>Predicted surface accessible antigenic sites by using Emini surface accessibility prediction analysis </bold>
[<xref ref-type="bibr" rid="B30">30</xref>
]</p>
</caption>
<table frame="hsides" rules="groups" border="1"><colgroup><col align="center"></col>
<col align="center"></col>
</colgroup>
<thead valign="top"><tr><th align="left"><bold>Peptide</bold>
</th>
<th align="center"><bold>Length (aa)</bold>
</th>
</tr>
</thead>
<tbody valign="top"><tr><td align="center" valign="bottom">HRHRLS<hr></hr>
</td>
<td align="center" valign="bottom">6<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">GNFNQDF<hr></hr>
</td>
<td align="center" valign="bottom">7<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">TDYNYYSYNL<hr></hr>
</td>
<td align="center" valign="bottom">10<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">ARVYYESMSYQEQD<hr></hr>
</td>
<td align="center" valign="bottom">14<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">AKNRAR<hr></hr>
</td>
<td align="center" valign="bottom">6<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">MTNRQYHQKML<hr></hr>
</td>
<td align="center" valign="bottom">11<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">TLYKDVD<hr></hr>
</td>
<td align="center" valign="bottom">7<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">WDYPKC<hr></hr>
</td>
<td align="center" valign="bottom">6<hr></hr>
</td>
</tr>
<tr><td align="center">TRDRFY</td>
<td align="center">6</td>
</tr>
</tbody>
</table>
</table-wrap>
</sec>
<sec><title>WDYPKCDRA is fully conserved among all human corona virus isolates</title>
<p>The conservancies of all epitopes were determined by IEDB conservancy analysis tools [<xref ref-type="bibr" rid="B31">31</xref>
]. From the IEDB predicted epitopes, two epitopes (YPKCDRA, LKYAIS) and from Bepipred predicted epitopes, YPKCDRA epitope were found to be 100% conserved among all human coronavirus isolates (Table <xref ref-type="table" rid="T4">4</xref>
). WDYPKC epitope from the surface accessible epitope was also found to be 100% conserved (Table <xref ref-type="table" rid="T4">4</xref>
). Among the two consensus epitopes of Bepipred [<xref ref-type="bibr" rid="B29">29</xref>
] and IEDB [<xref ref-type="bibr" rid="B28">28</xref>
] analysis, YPKCDRA epitope was found to be 100% conserved among all human coronavirus isolates (Figure <xref ref-type="fig" rid="F5">5</xref>
). This YPKCDRA and WDYPKC epitopes are in the same region and 100% conserved in all human coronaviruses. Therefore, the whole epitope WDYPKCDRA which is 100% conserved was then selected as the desired universal vaccine candidate.</p>
<table-wrap position="float" id="T4"><label>Table 4</label>
<caption><p><bold>Predicted conservancy of the antigenic site by using IEDB conservancy analysis </bold>
[<xref ref-type="bibr" rid="B31">31</xref>
]</p>
</caption>
<table frame="hsides" rules="groups" border="1"><colgroup><col align="center"></col>
<col align="right"></col>
</colgroup>
<thead valign="top"><tr><th align="left"><bold>Sequence</bold>
</th>
<th align="right"><bold>Identity %</bold>
</th>
</tr>
</thead>
<tbody valign="top"><tr><td colspan="2" align="center" valign="bottom"><bold>Bepipred analysis</bold>
<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">VRPGNFNQ<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">GNAAIT<hr></hr>
</td>
<td align="right" valign="bottom">41.30<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DKSAGHPFN<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">SYQEQ<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DVDNP<hr></hr>
</td>
<td align="right" valign="bottom">41.30<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YPKCDRA<hr></hr>
</td>
<td align="right" valign="bottom">100.00<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YYVKPGGTSSGDATTAY<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td colspan="2" align="center" valign="bottom"><bold>IEDB analysis</bold>
<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DYKVQLFEKYFKY<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">HANCVNCTDDRCVLHCANFNVLFAM<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">KTCFGPIVRKIFVDGVPFVVSCGYHYKELGLV<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">VSLHRHRLSLK<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">ADPAMHI<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">SSNAFLDLRTSCFSVAALTTG<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YDFVVSKG<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">SVTLKHFFFA<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DYNYYSYN<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">PTMCDIKQMLFCMEVVNKYFEI<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">DGGCLNASEVVVNN<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">KARVYYESM<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">LKYAIS<hr></hr>
</td>
<td align="right" valign="bottom">100.00<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">TVAGVSILS<hr></hr>
</td>
<td align="right" valign="bottom">41.30<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">GATCVIGTT<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">LKTLYKDV<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YPKCDRA<hr></hr>
</td>
<td align="right" valign="bottom">100.00<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">CRIFASLILARKHGTCCTT<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">YRLANECAQVLSEYVLCGGGYYVKPG<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">ANSVFNILQA<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">TANVSAL<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td colspan="2" align="center" valign="bottom"><bold>Surface accessibility prediction analysis</bold>
<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">HRHRLS<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">GNFNQDF<hr></hr>
</td>
<td align="right" valign="bottom">41.30<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">TDYNYYSYNL<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">ARVYYESMSYQEQD<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">AKNRAR<hr></hr>
</td>
<td align="right" valign="bottom">56.52<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">MTNRQYHQKML<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">TLYKDVD<hr></hr>
</td>
<td align="right" valign="bottom">17.39<hr></hr>
</td>
</tr>
<tr><td align="center" valign="bottom">WDYPKC<hr></hr>
</td>
<td align="right" valign="bottom">100.00<hr></hr>
</td>
</tr>
<tr><td align="center">TRDRFY</td>
<td align="right">17.39</td>
</tr>
</tbody>
</table>
</table-wrap>
<fig id="F5" position="float"><label>Figure 5</label>
<caption><p><bold>Conservancy of the predicted consensus epitopes.</bold>
Three of the four epitopes were found to be 100% conserved. Here Y axis indicates the epitopes and X axis indicates the conservancy percentage.</p>
</caption>
<graphic xlink:href="1471-2105-15-161-5"></graphic>
</fig>
</sec>
<sec><title>WDYPKCDRA is also an accessible epitope</title>
<p>Hydrophilicity is desired feature of B cell epitope which indicates the accessibility of the epitope. The WDYPKCDRA epitope was found to be hydrophilic (Figure <xref ref-type="fig" rid="F6">6</xref>
) in nature as determined by the IEDB Parker hydrophilicity analysis [<xref ref-type="bibr" rid="B32">32</xref>
]. A threshold of 3.448 was used which is indicated by the red line and the residues of the epitope which are hydrophilic are in the yellow region. The maximum level was found as 4.5 (Figure <xref ref-type="fig" rid="F6">6</xref>
) in the epitope.</p>
<fig id="F6" position="float"><label>Figure 6</label>
<caption><p><bold>Hydrophilicity of the WDYPKCDRA epitope.</bold>
Most of the residues of the desired WDYPKCDRA epitope were found to be hydrophilic in nature (in the yellow colored region). The residues which are below the cut off 3.448 (red line) are in the green region.</p>
</caption>
<graphic xlink:href="1471-2105-15-161-6"></graphic>
</fig>
</sec>
<sec><title>A tertiary structure of RNA directed RNA polymerase was predicted and validated using <italic>in silico</italic>
approach</title>
<p>As the experimental tertiary structure of the RNA directed RNA polymerase is not available, we modeled a 3D structure by I-TASSER server [<xref ref-type="bibr" rid="B33">33</xref>
] by multiple threading alignments. I-TASSER analysis deduced 5 different models (data not shown) for this protein. The quality of all the predicted protein models was checked by PROCHECK analysis [<xref ref-type="bibr" rid="B34">34</xref>
]. From the PROCHECK analysis results, the protein model in which maximum numbers of amino acids residues were in maximum favorable region and G factor was highest was taken as the desired best model. The model in which 89.3% residues are found to be in the most favored region in Ramachandran plot (Additional file <xref ref-type="supplementary-material" rid="S6">6</xref>
: Figure S6) and G-factor was -0.31 from the PROCHECK analysis was selected as the desired model. Along with the surface accessibility analysis and hydrophilicity analysis, the targeted WDYPKCDRA epitope was also found to be in the surface and accessible in the RNA directed RNA polymerase 3D structure (marked as green color) (Figure <xref ref-type="fig" rid="F7">7</xref>
).</p>
<fig id="F7" position="float"><label>Figure 7</label>
<caption><p><bold>3D structure of RNA directed RNA polymerase protein.</bold>
Predicted conserved WDYPKCDRA epitope mapped onto protein 3D structure using UCSF Chimera [<xref ref-type="bibr" rid="B35">35</xref>
] visualization tool. Here green colored region indicates the conserved epitope WDYPKCDRA.</p>
</caption>
<graphic xlink:href="1471-2105-15-161-7"></graphic>
</fig>
</sec>
</sec>
<sec sec-type="discussion"><title>Discussion</title>
<p>Coronaviruses are one of the most diverse groups of virus which are becoming a deadly virus day by day. Though the first two strains were not so much deadly but the other members were pathogenic. After SARS outbreak, a new coronavirus strain called MERS-CoV is now going to cause another outbreak [<xref ref-type="bibr" rid="B4">4</xref>
]. The cell tropism and cellular receptor of the six types of coronaviruses are not similar (Additional file <xref ref-type="supplementary-material" rid="S7">7</xref>
: Table S1). Though at first it was thought that SARS-CoV and MERS-CoV are structurally similar and tried to treat MERS-CoV infected patient with the SASR-CoV treatment. But it was found that they bind to two different receptors, namely ACE2 and DPP4 or CD26 respectively [<xref ref-type="bibr" rid="B36">36</xref>
]. These viruses are actually zoonotic origin, undergo recombination, and may be in future another strain of this group of virus will come [<xref ref-type="bibr" rid="B37">37</xref>
]. Therefore, it is important to take preventing measures not only to prevent this new strain of coronavirus, also against all the strain of coronavirus. There is no recommended vaccine for coronaviruses which is necessary to prevent. Most of the cases, vaccines were designed by targeting spike protein. Similarly, researchers also reported to design vaccine against SARS-CoV and MERS-CoV spike protein [<xref ref-type="bibr" rid="B38">38</xref>
,<xref ref-type="bibr" rid="B39">39</xref>
]. Fernando et al. also designed lived-attenuated MERS coronavirus by mutating MERS-CoV envelope protein as a vaccine which will be for only MERS-CoV [<xref ref-type="bibr" rid="B40">40</xref>
]. These vaccines would thus be effective for only those strains not for others. Giving a universal vaccine for all strain of viruses is much more promising solution rather than giving individual vaccine for individual strain.</p>
<p>The concept of prevention of viruses by designing a universal vaccine has also been reported previously, for example against Influenza virus. In case of influenza virus, universal vaccine against matrix 2 protein which was found to be conserved among all Influenza subtypes was reported [<xref ref-type="bibr" rid="B41">41</xref>
]. An attempt to design universal vaccine against members of coronaviruses, like feline infectious peritonitis (FIPV), canine coronavirus (CCV), gastroenteritis coronavirus (TGEV), bovine coronavirus (BCV) targeting their spike protein in 1993 were observed [<xref ref-type="bibr" rid="B42">42</xref>
]. But this concept was not applied to human coronaviruses.</p>
<p>Vaccine development has been one of the most important contributions of immunology to public health to date. Traditionally vaccines were based on the intact pathogen, either inactivated or live attenuated. These types of vaccines had some crucial drawbacks like safety consideration and the loss of efficacy due to the genetic variation of the pathogen. But now a day’s these vaccine concepts are greatly replaced by novel vaccine approaches like naked DNA vaccine, epitope based vaccine. The main benefit of immunization with an epitope-based vaccine is the ability to immunize with a minimal structure and it will stimulate an effective specific immune response, while avoiding potential undesirable effects [<xref ref-type="bibr" rid="B43">43</xref>
].</p>
<p>In this study, we aimed to design an epitope-based universal vaccine for all human coronavirus strain. For this purpose we did multiple sequence alignment of the spike (S), envelope (E), membrane (M), nucleocapsid (N) protein and replicase polyprotein 1ab of all six human coronaviruses. Replicase polyprotein 1ab was taken to check whether there is any conservancy among the non structural protein as this replicase polyprotein cleaved into 15 non-structural proteins. In case of S, E, M and N protein, no putative conserved region was found. But conserved region was found in case of replicae polyprotein 1ab where the conserved region was in the RNA directed RNA polymerase. This indicates that this protein is less mutating than the S, E, M and N protein. This RNA directed RNA polymerase protein was targeted to determine antigenic sites based on immunogenicity and surface accessibility using different bioinformatics analyses. The consensus antigenic sites were the desired one and their conservancy was also determined. From the conservancy analysis it was found that Bepipred [<xref ref-type="bibr" rid="B29">29</xref>
] and IEDB [<xref ref-type="bibr" rid="B28">28</xref>
] analysis predicted consensus epitope YPKCDRA and the surface accessibility analysis [<xref ref-type="bibr" rid="B30">30</xref>
] predicted epitope WDYPKC are 100% conserved. This 100% conserved WDYPKC and YPKCDRA are actually located in the same region of RNA directed RNA polymerase and it was then taken as the targeted epitope. This epitope was found to be accessible and hydrophilic which is one of the crucial requirements for an epitope to be used as a vaccine. This reflects a promising scope to use this conserved epitope as a universal vaccine both as preventive and therapeutic treatment. As this epitope remain long been conserved since 1960, it may be possible to use this vaccine in future for upcoming human coronavirus strains as well. To become an effective vaccine, it needs to be highly immunogenic, stable inside the body. If it is poorly immunogenic or unstable, it needs to be conjugated with adjuvant [<xref ref-type="bibr" rid="B44">44</xref>
]. Though this epitope based vaccine is designed by <italic>in silico</italic>
analyses, the actual immunogenicity, stability, efficacy and their delivery strategy inside the recipients body can’t be determined by this <italic>in silico</italic>
analysis. To address these questions <italic>in vitro</italic>
and <italic>in vivo</italic>
experiments are essential.</p>
</sec>
<sec sec-type="conclusions"><title>Conclusions</title>
<p>This study shows that though the human coronaviruses are not structurally related but it is possible to design an epitope-based universal vaccine for all human coronavirus strains. Our results are based on sequence analysis and computational predictions show predicted epitope would be a candidate target for the universal vaccine; and to determine the actual effectiveness of the peptide for mounting an immune response both <italic>in vitro</italic>
and <italic>in vivo</italic>
studies can be performed.</p>
</sec>
<sec sec-type="methods"><title>Methods</title>
<sec><title>Retrieving coronavirus structural and nonstructural protein sequences</title>
<p>A total available 46 replicase polyprotein 1ab, 17 spike (S) protein, 18 envelope (E) protein, 18 membrane (M) and 18 nucleocapsid (N) protein sequence data were retrieved from NCBI GenBank sequence database [<xref ref-type="bibr" rid="B45">45</xref>
] (Additional file <xref ref-type="supplementary-material" rid="S7">7</xref>
: Table S1).</p>
</sec>
<sec><title>Identification of conserved region</title>
<p>To find the conserved region, retrieved sequences were aligned using EBI-clustalW program [<xref ref-type="bibr" rid="B23">23</xref>
]. This multiple sequence alignment (MSA) was done with Gonnet matrix [<xref ref-type="bibr" rid="B23">23</xref>
]. Protein variability server (PVS) was used to calculate protein variability index using Wu-kabat Variability coefficient [<xref ref-type="bibr" rid="B24">24</xref>
]. From the multiple sequence alignment where the highest number of identical and similar amino acid and no gap was found, the sequence was selected as a conserved region. That conserved region was then used for antigenic site prediction.</p>
</sec>
<sec><title>Detection of immunogenicity of conserved peptides</title>
<p>To evaluate the immunogenicity of the conserved peptides, various bioinformatics algorithms and computational tools were used. Bepipred (v1.0) [<xref ref-type="bibr" rid="B29">29</xref>
] and B cell epitope prediction tools of The Immune Epitope Database (IEDB) [<xref ref-type="bibr" rid="B28">28</xref>
] were used for this purpose. Bepipred predicts linear B-cell epitopes using hidden Markov model [<xref ref-type="bibr" rid="B29">29</xref>
]. Default threshold 0.35 was used for Bepipred analysis. Among B cell epitope prediction tools of IEDB, prediction of linear epitopes from protein sequence tool was used. The Immune Epitope Database (IEDB) linear epitope prediction tools [<xref ref-type="bibr" rid="B28">28</xref>
] made the option of using different prediction methods. Finally Kolaskar and Tongaonkar Antigenicity method [<xref ref-type="bibr" rid="B27">27</xref>
] was applied in this study using a threshold of 1.000 because it predicts the antigenicity of the provided protein sequence. The epitopes which were found to be fully or at least 90% overlap between IEDB B-cell epitope prediction tool [<xref ref-type="bibr" rid="B28">28</xref>
] and Bepipred prediction [<xref ref-type="bibr" rid="B29">29</xref>
] are chosen as desired epitope sequences.</p>
</sec>
<sec><title>Prediction of surface accessible epitopes</title>
<p>To predict the surface accessible epitope of the conserved peptide, Emini surface accessibility prediction tool [<xref ref-type="bibr" rid="B30">30</xref>
] of the B cell epitope prediction tools of The Immune Epitope Database (IEDB) [<xref ref-type="bibr" rid="B28">28</xref>
] was used for this purpose using default threshold level 1.0.</p>
</sec>
<sec><title>Prediction of epitope conservancy</title>
<p>The epitope conservancy analysis tool from the IEDB analysis resource was employed for epitope conservancy prediction [<xref ref-type="bibr" rid="B31">31</xref>
] of all predicted epitopes. The conservancy level of the epitopes were calculated by searching for identities in the given protein sequence.</p>
</sec>
<sec><title>Prediction of epitope hydrophilicity</title>
<p>The conserved epitope was then also analyzed to determine the hydrophilicity of the predicted epitopes. Parker hydrophilicity prediction tool [<xref ref-type="bibr" rid="B32">32</xref>
] of Immune Epitope Database (IEDB) [<xref ref-type="bibr" rid="B28">28</xref>
] was used for this purpose and default threshold 3.448 was used.</p>
</sec>
<sec><title>Prediction and evaluation protein 3D model</title>
<p>As the experimental structure of RNA directed RNA polymerase protein of any human coronavirus isolate was not found in protein data bank (PDB), a 3D structure was predicted using I-TASSER server [<xref ref-type="bibr" rid="B33">33</xref>
]. I-TASSER server gives protein 3D structure by multiple threading alignments [<xref ref-type="bibr" rid="B33">33</xref>
]. I-TASSER provided top models quality was then verified by PROCHECK software [<xref ref-type="bibr" rid="B34">34</xref>
]. The model for which G factor was highest, and amino acid residues in favorable region was higher in PROCHECK analysis was selected as the best model. This model was then used to locate the epitope by using UCSF Chimera [<xref ref-type="bibr" rid="B35">35</xref>
] visualization tool.</p>
</sec>
</sec>
<sec><title>Abbreviations</title>
<p>HCoV: Human coronavirus; SARS: Severe acute respiratory syndrome; SARS-CoV: SARS coronavirus; MERS-CoV: Middle east respiratory syndrome coronavirus; HCoV-229E: Human coronavirus 229E; HCoV-OC43: Human coronavirus OC43; HCoV-NL63: Human coronavirus NL63; HCoV-HKU1: Human coronavirus HKU1; ACE2: AngiotensinI-converting enzyme 2; DPP4: Dipeptyl peptidae 4.</p>
</sec>
<sec><title>Competing interests</title>
<p>The authors declare that they have no competing interests.</p>
</sec>
<sec><title>Authors’ contributions</title>
<p>RS & AI performed the analysis. AI conceived the project idea. RS and AI wrote the manuscript. Both authors read and approved the final manuscript.</p>
</sec>
<sec sec-type="supplementary-material"><title>Supplementary Material</title>
<supplementary-material content-type="local-data" id="S1"><caption><title>Additional file 1: Figure S1</title>
<p>Multiple sequence alignment of Spike (S) protein: Multiple sequence alignment of total 17 numbers of sequences of human coronaviruse isolates indicate that there is no conservation in their spike protein. This alignment was visualized by Jalview 2.8 [<xref ref-type="bibr" rid="B25">25</xref>
] and color scheme used is Clustalx. Conservation showed here is based on 11 base scales where yellow color bar and star sign indicates the full conservation. Alignment quality was based on BLOSUM 62 substitution matrix score where yellow color indicates good quality. All the colors changes according to the conservation and alignment quality. Black bars showed the consensus sequence.</p>
</caption>
<media xlink:href="1471-2105-15-161-S1.jpeg"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
<supplementary-material content-type="local-data" id="S2"><caption><title>Additional file 2: Figure S2</title>
<p>Multiple sequence alignment of envelope (E) protein: Figure legend as in supplementary Figure S1.</p>
</caption>
<media xlink:href="1471-2105-15-161-S2.tiff"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
<supplementary-material content-type="local-data" id="S3"><caption><title>Additional file 3: Figure S3</title>
<p>Multiple sequence alignment of membrane (M) protein: Figure legend as in supplementary Figure S1.</p>
</caption>
<media xlink:href="1471-2105-15-161-S3.tiff"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
<supplementary-material content-type="local-data" id="S4"><caption><title>Additional file 4: Figure S4</title>
<p>Multiple sequence alignment of nucleocapsid (N) protein: Figure legend as in supplementary Figure S1.</p>
</caption>
<media xlink:href="1471-2105-15-161-S4.tiff"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
<supplementary-material content-type="local-data" id="S5"><caption><title>Additional file 5: Figure S5</title>
<p>Conserved peptide found in RNA directed RNA polymerase by multiple sequence alignment of replicase polyprotein 1ab: All human coronaviruses are found to be conserved in their replicase polyprotein 1ab.</p>
</caption>
<media xlink:href="1471-2105-15-161-S5.tiff"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
<supplementary-material content-type="local-data" id="S6"><caption><title>Additional file 6: Figure S6.</title>
<p>Ramachandran plot for RNA directed RNA polymerase protein: Red colored region is the most favored region, brown and yellow colored regions are additionally allowed region and generously allowed regions respectively.</p>
</caption>
<media xlink:href="1471-2105-15-161-S6.tiff"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
<supplementary-material content-type="local-data" id="S7"><caption><title>Additional file 7: Table S1.</title>
<p>Sequence sources and other sequence related information.</p>
</caption>
<media xlink:href="1471-2105-15-161-S7.xlsx"><caption><p>Click here for file</p>
</caption>
</media>
</supplementary-material>
</sec>
</body>
<back><sec><title>Acknowledgement</title>
<p>RS is a recipient of NST fellowship from Ministry of Science and Technology, Govt. of Bangladesh.</p>
</sec>
<ref-list><ref id="B1"><mixed-citation publication-type="book"><name><surname>Luis</surname>
<given-names>E</given-names>
</name>
<name><surname>Isabel</surname>
<given-names>S</given-names>
</name>
<name><surname>Sonia</surname>
<given-names>Z</given-names>
</name>
<name><surname>Fernando</surname>
<given-names>A</given-names>
</name>
<article-title>Coronavirus Replication and Interaction with Host</article-title>
<source>Animal Viruses: Molecular Biology</source>
<year>2008</year>
<publisher-name>UK: Caister Academic Press</publisher-name>
<fpage>149</fpage>
<lpage>202</lpage>
</mixed-citation>
</ref>
<ref id="B2"><mixed-citation publication-type="book"><name><surname>De Groot</surname>
<given-names>RJ</given-names>
</name>
<name><surname>Baker</surname>
<given-names>SC</given-names>
</name>
<name><surname>Baric</surname>
<given-names>R</given-names>
</name>
<name><surname>Enjuanes</surname>
<given-names>L</given-names>
</name>
<name><surname>Gorbalenya</surname>
<given-names>AE</given-names>
</name>
<name><surname>Holmes</surname>
<given-names>KV</given-names>
</name>
<name><surname>Perlman</surname>
<given-names>S</given-names>
</name>
<name><surname>Poon</surname>
<given-names>L</given-names>
</name>
<name><surname>Rottier</surname>
<given-names>PJM</given-names>
</name>
<name><surname>Talbot</surname>
<given-names>PJ</given-names>
</name>
<name><surname>Woo</surname>
<given-names>PCY</given-names>
</name>
<name><surname>Ziebuhr</surname>
<given-names>J</given-names>
</name>
<article-title>Family Coronaviridae</article-title>
<source>International Committee on Taxonomy of Viruses. (ninth report)</source>
<year>2011</year>
<publisher-name>Oxford: Elsevier</publisher-name>
<fpage>806</fpage>
<lpage>828</lpage>
</mixed-citation>
</ref>
<ref id="B3"><mixed-citation publication-type="journal"><name><surname>Lu</surname>
<given-names>R</given-names>
</name>
<name><surname>Yu</surname>
<given-names>X</given-names>
</name>
<name><surname>Wang</surname>
<given-names>W</given-names>
</name>
<name><surname>Duan</surname>
<given-names>X</given-names>
</name>
<name><surname>Zhang</surname>
<given-names>L</given-names>
</name>
<name><surname>Roujian</surname>
<given-names>L</given-names>
</name>
<name><surname>Xiaoyan</surname>
<given-names>Y</given-names>
</name>
<name><surname>Wen</surname>
<given-names>W</given-names>
</name>
<name><surname>Xijie</surname>
<given-names>D</given-names>
</name>
<name><surname>Linglin</surname>
<given-names>Z</given-names>
</name>
<name><surname>Weimin</surname>
<given-names>Z</given-names>
</name>
<name><surname>Jin</surname>
<given-names>X</given-names>
</name>
<name><surname>Lingjie</surname>
<given-names>X</given-names>
</name>
<name><surname>Qin</surname>
<given-names>H</given-names>
</name>
<name><surname>Jianxin</surname>
<given-names>L</given-names>
</name>
<name><surname>Li</surname>
<given-names>R</given-names>
</name>
<name><surname>Zhong</surname>
<given-names>W</given-names>
</name>
<name><surname>Wenjie</surname>
<given-names>T</given-names>
</name>
<article-title>Characterization of human coronavirus etiology in Chinese adults with acute upper respiratory tract infection by real-timeRT-PCR assays</article-title>
<source>PLoS One</source>
<year>2012</year>
<volume>7</volume>
<issue>6</issue>
<fpage>e38638</fpage>
<pub-id pub-id-type="doi">10.1371/journal.pone.0038638</pub-id>
<pub-id pub-id-type="pmid">22719912</pub-id>
</mixed-citation>
</ref>
<ref id="B4"><mixed-citation publication-type="book"><collab>Global alert and response (GAR)</collab>
<source>Middle East respiratory syndrome coronavirus (MERS-CoV) – update</source>
<year>2014</year>
<publisher-name>World Health Organization</publisher-name>
<comment>[<ext-link ext-link-type="uri" xlink:href="http://www.who.int/csr/don/2014_01_09/en/">http://www.who.int/csr/don/2014_01_09/en/</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B5"><mixed-citation publication-type="journal"><name><surname>Boheemen</surname>
<given-names>S</given-names>
</name>
<name><surname>Sander</surname>
<given-names>B</given-names>
</name>
<name><surname>Miranda</surname>
<given-names>G</given-names>
</name>
<name><surname>Chris</surname>
<given-names>L</given-names>
</name>
<name><surname>Theo</surname>
<given-names>MB</given-names>
</name>
<name><surname>Stalin</surname>
<given-names>R</given-names>
</name>
<name><surname>Ali</surname>
<given-names>MZ</given-names>
</name>
<name><surname>Albert</surname>
<given-names>DME</given-names>
</name>
<name><surname>Bart</surname>
<given-names>LH</given-names>
</name>
<name><surname>Osterhaus</surname>
<given-names>AD</given-names>
</name>
<name><surname>Alexander</surname>
<given-names>EG</given-names>
</name>
<name><surname>Eric</surname>
<given-names>JS</given-names>
</name>
<name><surname>Ron</surname>
<given-names>AMF</given-names>
</name>
<article-title>Genomic characterization of a newly discovered coronavirus associated with acute respiratory distress syndrome in humans</article-title>
<source>mBio</source>
<year>2012</year>
<volume>3</volume>
<issue>6</issue>
<fpage>e00473</fpage>
<lpage>12</lpage>
<pub-id pub-id-type="pmid">23170002</pub-id>
</mixed-citation>
</ref>
<ref id="B6"><mixed-citation publication-type="journal"><name><surname>Wever</surname>
<given-names>BA</given-names>
</name>
<name><surname>Van der Hoek</surname>
<given-names>L</given-names>
</name>
<article-title>Recently discovered human coronaviruses</article-title>
<source>Clin Lab Med</source>
<year>2009</year>
<volume>29</volume>
<issue>4</issue>
<fpage>715</fpage>
<lpage>724</lpage>
<pub-id pub-id-type="doi">10.1016/j.cll.2009.07.007</pub-id>
<pub-id pub-id-type="pmid">19892230</pub-id>
</mixed-citation>
</ref>
<ref id="B7"><mixed-citation publication-type="journal"><name><surname>Chan-Yeung</surname>
<given-names>M</given-names>
</name>
<name><surname>Xu</surname>
<given-names>RH</given-names>
</name>
<article-title>SARS: epidemiology</article-title>
<source>Respirology</source>
<year>2003</year>
<volume>8</volume>
<fpage>S9</fpage>
<lpage>S14</lpage>
<pub-id pub-id-type="doi">10.1046/j.1440-1843.2003.00518.x</pub-id>
<pub-id pub-id-type="pmid">15018127</pub-id>
</mixed-citation>
</ref>
<ref id="B8"><mixed-citation publication-type="journal"><name><surname>Hofmann</surname>
<given-names>H</given-names>
</name>
<name><surname>Pyrc</surname>
<given-names>K</given-names>
</name>
<name><surname>Van der Hoek</surname>
<given-names>L</given-names>
</name>
<name><surname>Geier</surname>
<given-names>M</given-names>
</name>
<name><surname>Ben</surname>
<given-names>B</given-names>
</name>
<name><surname>Stefan</surname>
<given-names>P</given-names>
</name>
<article-title>Human coronavirus NL63 employs the severe acute respiratory syndrome coronavirus receptor for cellular entry</article-title>
<source>Proc Natl Acad Sci U S A</source>
<year>2005</year>
<volume>102</volume>
<issue>22</issue>
<fpage>7988</fpage>
<lpage>7993</lpage>
<pub-id pub-id-type="doi">10.1073/pnas.0409465102</pub-id>
<pub-id pub-id-type="pmid">15897467</pub-id>
</mixed-citation>
</ref>
<ref id="B9"><mixed-citation publication-type="journal"><name><surname>Ali Mohamed</surname>
<given-names>Z</given-names>
</name>
<name><surname>Van Boheemen</surname>
<given-names>S</given-names>
</name>
<name><surname>Bestebroer</surname>
<given-names>TM</given-names>
</name>
<name><surname>Albert</surname>
<given-names>DME</given-names>
</name>
<name><surname>Osterhaus</surname>
<given-names>AD</given-names>
</name>
<name><surname>Ron</surname>
<given-names>AM</given-names>
</name>
<name><surname>Fouchier</surname>
<given-names>RA</given-names>
</name>
<article-title>Isolation of a novel coronavirus from a man with pneumonia in Saudi Arabia</article-title>
<source>N Engl J Med</source>
<year>2012</year>
<volume>367</volume>
<fpage>1814</fpage>
<pub-id pub-id-type="doi">10.1056/NEJMoa1211721</pub-id>
<pub-id pub-id-type="pmid">23075143</pub-id>
</mixed-citation>
</ref>
<ref id="B10"><mixed-citation publication-type="journal"><name><surname>Sørensen</surname>
<given-names>MD</given-names>
</name>
<name><surname>Sørensen</surname>
<given-names>B</given-names>
</name>
<name><surname>Gonzalez-Dosal</surname>
<given-names>R</given-names>
</name>
<name><surname>Melchjorsen</surname>
<given-names>CJ</given-names>
</name>
<name><surname>Weibel</surname>
<given-names>J</given-names>
</name>
<name><surname>Wang</surname>
<given-names>J</given-names>
</name>
<name><surname>Jun</surname>
<given-names>CW</given-names>
</name>
<name><surname>Huanming</surname>
<given-names>Y</given-names>
</name>
<name><surname>Kristensen</surname>
<given-names>P</given-names>
</name>
<article-title>Severe acute respiratory syndrome (SARS): development of diagnostics and antivirals</article-title>
<source>Ann N Y Acad Sci</source>
<year>2006</year>
<volume>1067</volume>
<fpage>500</fpage>
<lpage>505</lpage>
<comment>PMID 16804033</comment>
<pub-id pub-id-type="doi">10.1196/annals.1354.072</pub-id>
<pub-id pub-id-type="pmid">16804033</pub-id>
</mixed-citation>
</ref>
<ref id="B11"><mixed-citation publication-type="journal"><name><surname>Cheng</surname>
<given-names>VC</given-names>
</name>
<name><surname>Lau</surname>
<given-names>SK</given-names>
</name>
<name><surname>Woo</surname>
<given-names>PC</given-names>
</name>
<name><surname>Yuen</surname>
<given-names>KY</given-names>
</name>
<article-title>Severe acute respiratory syndrome coronavirus as an agent of emerging and reemerging infection</article-title>
<source>Clin Microbiol Rev</source>
<year>2007</year>
<volume>20</volume>
<fpage>660e94</fpage>
<pub-id pub-id-type="pmid">17934078</pub-id>
</mixed-citation>
</ref>
<ref id="B12"><mixed-citation publication-type="other"><name><surname>Pierre</surname>
<given-names>S</given-names>
</name>
<article-title>First coronavirus sufferer in France dies in hospital Reuters</article-title>
<year>2013</year>
<comment>[<ext-link ext-link-type="uri" xlink:href="http://uk.reuters.com/article/2013/05/28/uk-coronavirus-france-idUKBRE94R0Y320130528">http://uk.reuters.com/article/2013/05/28/uk-coronavirus-france-idUKBRE94R0Y320130528</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B13"><mixed-citation publication-type="other"><name><surname>Robert</surname>
<given-names>R</given-names>
</name>
<article-title>Coronavirus cases, deaths reported in Tunisia, Saudi Arabia</article-title>
<year>2013</year>
<comment>[<ext-link ext-link-type="uri" xlink:href="http://www.cidrap.umn.edu/news-perspective/2013/05/coronavirus-cases-deaths-reported-tunisia-saudi-arabia">http://www.cidrap.umn.edu/news-perspective/2013/05/coronavirus-cases-deaths-reported-tunisia-saudi-arabia</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B14"><mixed-citation publication-type="other"><name><surname>Helen</surname>
<given-names>B</given-names>
</name>
<article-title>Spain reports its first MERS case; woman travelled to Saudi Arabia for Hajj</article-title>
<year>2013</year>
<comment>[<ext-link ext-link-type="uri" xlink:href="http://www.vancouversun.com/health/Spain+reports+first+MERS+case+woman+travelled+Saudi+Arabia+Hajj/9133754/story.html">http://www.vancouversun.com/health/Spain+reports+first+MERS+case+woman+travelled+Saudi+Arabia+Hajj/9133754/story.html</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B15"><mixed-citation publication-type="other"><article-title>Middle East respiratory syndrome coronavirus (MERS-CoV)</article-title>
<year>2014</year>
<comment>[<ext-link ext-link-type="uri" xlink:href="http://www.cdc.gov/coronavirus/MERS/faq.html">http://www.cdc.gov/coronavirus/MERS/faq.html</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B16"><mixed-citation publication-type="journal"><name><surname>Falzarano</surname>
<given-names>D</given-names>
</name>
<name><surname>Darryl</surname>
<given-names>F</given-names>
</name>
<name><surname>De Emmie</surname>
<given-names>W</given-names>
</name>
<name><surname>Cynthia</surname>
<given-names>M</given-names>
</name>
<name><surname>Julie</surname>
<given-names>C</given-names>
</name>
<name><surname>Vincent</surname>
<given-names>J</given-names>
</name>
<name><surname>Heinz</surname>
<given-names>F</given-names>
</name>
<name><surname>Munster</surname>
<given-names>VJ</given-names>
</name>
<article-title>Inhibition of novel beta coronavirus replication by a combination of interferon-alpha2b and ribavirin</article-title>
<source>Sci Rep</source>
<year>2013</year>
<volume>3</volume>
<fpage>1686</fpage>
<pub-id pub-id-type="pmid">23594967</pub-id>
</mixed-citation>
</ref>
<ref id="B17"><mixed-citation publication-type="journal"><name><surname>Wong</surname>
<given-names>SS</given-names>
</name>
<name><surname>Yuen</surname>
<given-names>KY</given-names>
</name>
<article-title>The management of coronavirus infections with particular reference to SARS</article-title>
<source>J Antimicrob Chemother</source>
<year>2008</year>
<volume>62</volume>
<fpage>437</fpage>
<lpage>441</lpage>
<pub-id pub-id-type="doi">10.1093/jac/dkn243</pub-id>
<pub-id pub-id-type="pmid">18565970</pub-id>
</mixed-citation>
</ref>
<ref id="B18"><mixed-citation publication-type="other"><article-title>Coronavirus</article-title>
<comment>[<ext-link ext-link-type="uri" xlink:href="http://www.cdc.gov/coronavirus/about/index.html">http://www.cdc.gov/coronavirus/about/index.html</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B19"><mixed-citation publication-type="journal"><name><surname>Xianfu</surname>
<given-names>W</given-names>
</name>
<name><surname>Smith</surname>
<given-names>TG</given-names>
</name>
<name><surname>Rupprecht</surname>
<given-names>CE</given-names>
</name>
<article-title>From brain passage to cell adaptation: the road of human rabies vaccine development</article-title>
<source>Exper Rev Vaccines</source>
<year>2011</year>
<volume>10</volume>
<issue>11</issue>
<fpage>1597</fpage>
<lpage>1608</lpage>
<pub-id pub-id-type="doi">10.1586/erv.11.140</pub-id>
</mixed-citation>
</ref>
<ref id="B20"><mixed-citation publication-type="journal"><name><surname>Plotkin</surname>
<given-names>SA</given-names>
</name>
<article-title>Vaccines: Past, present and future</article-title>
<source>Nat Med</source>
<year>2005</year>
<volume>11</volume>
<issue>4</issue>
<fpage>S5</fpage>
<lpage>S11</lpage>
<pub-id pub-id-type="pmid">15812490</pub-id>
</mixed-citation>
</ref>
<ref id="B21"><mixed-citation publication-type="journal"><name><surname>Matthew</surname>
<given-names>C</given-names>
</name>
<name><surname>Lam</surname>
<given-names>TT</given-names>
</name>
<name><surname>Watson</surname>
<given-names>SJ</given-names>
</name>
<name><surname>Annie</surname>
<given-names>LP</given-names>
</name>
<name><surname>Velilava</surname>
<given-names>P</given-names>
</name>
<name><surname>Paul</surname>
<given-names>G</given-names>
</name>
<name><surname>Oliver</surname>
<given-names>GP</given-names>
</name>
<name><surname>Andrew</surname>
<given-names>R</given-names>
</name>
<name><surname>Yi</surname>
<given-names>G</given-names>
</name>
<name><surname>Deenan</surname>
<given-names>P</given-names>
</name>
<name><surname>Paul</surname>
<given-names>K</given-names>
</name>
<name><surname>Eleni</surname>
<given-names>K</given-names>
</name>
<article-title>Full-genome deep sequencing and phylogenetic analysis of novel human betacoronavirus</article-title>
<source>Emerg Infect Dis</source>
<year>2013</year>
<volume>19</volume>
<fpage>5</fpage>
</mixed-citation>
</ref>
<ref id="B22"><mixed-citation publication-type="journal"><name><surname>Islam</surname>
<given-names>R</given-names>
</name>
<name><surname>Sadman</surname>
<given-names>S</given-names>
</name>
<name><surname>Aubhishek</surname>
<given-names>Z</given-names>
</name>
<article-title>A computational assay to design an epitope-based peptide vaccine against Chikungunya virus</article-title>
<source>Future Virol</source>
<year>2012</year>
<volume>7</volume>
<issue>10</issue>
<fpage>1029</fpage>
<lpage>1042</lpage>
<pub-id pub-id-type="doi">10.2217/fvl.12.95</pub-id>
</mixed-citation>
</ref>
<ref id="B23"><mixed-citation publication-type="journal"><name><surname>Thompson</surname>
<given-names>JD</given-names>
</name>
<name><surname>Higgins</surname>
<given-names>DG</given-names>
</name>
<name><surname>Gibson</surname>
<given-names>TJ</given-names>
</name>
<article-title>CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice</article-title>
<source>Nucleic Acids Res</source>
<year>1994</year>
<volume>22</volume>
<issue>22</issue>
<fpage>4673</fpage>
<lpage>4680</lpage>
<pub-id pub-id-type="doi">10.1093/nar/22.22.4673</pub-id>
<pub-id pub-id-type="pmid">7984417</pub-id>
</mixed-citation>
</ref>
<ref id="B24"><mixed-citation publication-type="journal"><name><surname>Garcia-Boronat</surname>
<given-names>M</given-names>
</name>
<name><surname>Diez-Rivero</surname>
<given-names>CM</given-names>
</name>
<name><surname>Reinherz</surname>
<given-names>EL</given-names>
</name>
<name><surname>Pedro</surname>
<given-names>AR</given-names>
</name>
<article-title>PVS: a web server for protein sequence variability analysis tuned to facilitate conserved epitope discovery</article-title>
<source>Nucleic Acids Res</source>
<year>2008</year>
<volume>36</volume>
<issue>Web Server issue</issue>
<fpage>W35</fpage>
<lpage>W41</lpage>
<pub-id pub-id-type="pmid">18442995</pub-id>
</mixed-citation>
</ref>
<ref id="B25"><mixed-citation publication-type="journal"><name><surname>Waterhouse</surname>
<given-names>AM</given-names>
</name>
<name><surname>Procter</surname>
<given-names>JB</given-names>
</name>
<name><surname>Martin</surname>
<given-names>DM</given-names>
</name>
<name><surname>Clamp</surname>
<given-names>M</given-names>
</name>
<name><surname>Barton</surname>
<given-names>GJ</given-names>
</name>
<article-title>Jalview Version 2-a multiple sequence alignment editor and analysis workbench</article-title>
<source>Bioinformatics</source>
<year>2009</year>
<volume>25</volume>
<fpage>1189</fpage>
<lpage>1191</lpage>
<pub-id pub-id-type="doi">10.1093/bioinformatics/btp033</pub-id>
<pub-id pub-id-type="pmid">19151095</pub-id>
</mixed-citation>
</ref>
<ref id="B26"><mixed-citation publication-type="journal"><name><surname>Caoili</surname>
<given-names>SEC</given-names>
</name>
<article-title>B-cell epitope prediction for peptide-based vaccine design: towards a paradigm of biological outcomes for global health</article-title>
<source>Immunome Res</source>
<year>2011</year>
<volume>7</volume>
<fpage>2</fpage>
<comment>2</comment>
</mixed-citation>
</ref>
<ref id="B27"><mixed-citation publication-type="journal"><name><surname>Kolaskar</surname>
<given-names>A</given-names>
</name>
<name><surname>Tongaonkar</surname>
<given-names>PC</given-names>
</name>
<article-title>A semiempirical method for prediction of antigenic determinants on protein antigens</article-title>
<source>FEBS Lett</source>
<year>1990</year>
<volume>276</volume>
<issue>1</issue>
<fpage>172</fpage>
<lpage>174</lpage>
<pub-id pub-id-type="pmid">1702393</pub-id>
</mixed-citation>
</ref>
<ref id="B28"><mixed-citation publication-type="journal"><name><surname>Vita</surname>
<given-names>R</given-names>
</name>
<name><surname>Zarebski</surname>
<given-names>L</given-names>
</name>
<name><surname>Greenbaum</surname>
<given-names>JA</given-names>
</name>
<name><surname>Emami</surname>
<given-names>H</given-names>
</name>
<name><surname>Hoof</surname>
<given-names>I</given-names>
</name>
<name><surname>Salimi</surname>
<given-names>N</given-names>
</name>
<name><surname>Damle</surname>
<given-names>R</given-names>
</name>
<name><surname>Sette</surname>
<given-names>A</given-names>
</name>
<name><surname>Peters</surname>
<given-names>B</given-names>
</name>
<article-title>The immune epitope database 2.0</article-title>
<source>Nucleic Acids Res</source>
<year>2010</year>
<volume>38</volume>
<issue>Database issue</issue>
<fpage>D854</fpage>
<lpage>D862</lpage>
<pub-id pub-id-type="pmid">19906713</pub-id>
</mixed-citation>
</ref>
<ref id="B29"><mixed-citation publication-type="journal"><name><surname>Jens Erik</surname>
<given-names>PL</given-names>
</name>
<name><surname>Pontoppidan</surname>
<given-names>L</given-names>
</name>
<name><surname>Ole</surname>
<given-names>L</given-names>
</name>
<name><surname>Morten</surname>
<given-names>N</given-names>
</name>
<article-title>Improved method for predicting linear B-cell epitopes</article-title>
<source>Immunome Res</source>
<year>2006</year>
<volume>2</volume>
<fpage>2</fpage>
<pub-id pub-id-type="doi">10.1186/1745-7580-2-2</pub-id>
<pub-id pub-id-type="pmid">16635264</pub-id>
</mixed-citation>
</ref>
<ref id="B30"><mixed-citation publication-type="journal"><name><surname>Emini</surname>
<given-names>EA</given-names>
</name>
<name><surname>Hughes</surname>
<given-names>JV</given-names>
</name>
<name><surname>Perlow</surname>
<given-names>DS</given-names>
</name>
<name><surname>Boger</surname>
<given-names>J</given-names>
</name>
<article-title>Induction of hepatitis A virus-neutralizing antibody by a virus-specific synthetic peptide</article-title>
<source>J Virol</source>
<year>1985</year>
<volume>55</volume>
<issue>3</issue>
<fpage>836</fpage>
<lpage>839</lpage>
<pub-id pub-id-type="pmid">2991600</pub-id>
</mixed-citation>
</ref>
<ref id="B31"><mixed-citation publication-type="journal"><name><surname>Bui</surname>
<given-names>HH</given-names>
</name>
<name><surname>Sidney</surname>
<given-names>J</given-names>
</name>
<name><surname>Li</surname>
<given-names>W</given-names>
</name>
<name><surname>Fusseder</surname>
<given-names>N</given-names>
</name>
<name><surname>Sette</surname>
<given-names>A</given-names>
</name>
<article-title>Development of an epitope conservancy analysis tool to facilitate the design of epitope-based diagnostics and vaccines</article-title>
<source>BMC Bioinformatics</source>
<year>2007</year>
<volume>8</volume>
<issue>1</issue>
<fpage>361</fpage>
<comment>PMID: 17897458</comment>
<pub-id pub-id-type="doi">10.1186/1471-2105-8-361</pub-id>
<pub-id pub-id-type="pmid">17897458</pub-id>
</mixed-citation>
</ref>
<ref id="B32"><mixed-citation publication-type="journal"><name><surname>Parker</surname>
<given-names>JM</given-names>
</name>
<name><surname>Guo</surname>
<given-names>D</given-names>
</name>
<name><surname>Hodges</surname>
<given-names>RS</given-names>
</name>
<article-title>New hydrophilicity scale derived from high performance liquid chromatography peptide retention data: correlation of predicted surface residues with antigenicity and X-ray-derived accessible sites</article-title>
<source>Biochemistry</source>
<year>1986</year>
<volume>23</volume>
<fpage>25</fpage>
</mixed-citation>
</ref>
<ref id="B33"><mixed-citation publication-type="journal"><name><surname>Zhang</surname>
<given-names>Y</given-names>
</name>
<article-title>I-TASSER server for protein 3D structure prediction</article-title>
<source>BMC Bioinformatics</source>
<year>2008</year>
<volume>9</volume>
<fpage>40</fpage>
<pub-id pub-id-type="doi">10.1186/1471-2105-9-40</pub-id>
<pub-id pub-id-type="pmid">18215316</pub-id>
</mixed-citation>
</ref>
<ref id="B34"><mixed-citation publication-type="journal"><name><surname>Laskowski</surname>
<given-names>RA</given-names>
</name>
<name><surname>MacArthur</surname>
<given-names>MW</given-names>
</name>
<name><surname>Moss</surname>
<given-names>DS</given-names>
</name>
<name><surname>Thornton</surname>
<given-names>JM</given-names>
</name>
<article-title>PROCHECK: a <bold>program to check the stereochemical qualit</bold>
of protein structures</article-title>
<source>J Appl Cryst</source>
<year>2001</year>
<volume>26</volume>
<fpage>283</fpage>
<lpage>291</lpage>
</mixed-citation>
</ref>
<ref id="B35"><mixed-citation publication-type="journal"><name><surname>Pettersen</surname>
<given-names>EF</given-names>
</name>
<name><surname>Goddard</surname>
<given-names>TD</given-names>
</name>
<name><surname>Huang</surname>
<given-names>CC</given-names>
</name>
<article-title>UCSF Chimera- a visualization system for exploratory research and analysis</article-title>
<source>J Comput Chem</source>
<year>2004</year>
<volume>25</volume>
<fpage>1605</fpage>
<lpage>1612</lpage>
<pub-id pub-id-type="doi">10.1002/jcc.20084</pub-id>
<pub-id pub-id-type="pmid">15264254</pub-id>
</mixed-citation>
</ref>
<ref id="B36"><mixed-citation publication-type="journal"><name><surname>To</surname>
<given-names>KKW</given-names>
</name>
<name><surname>Hung</surname>
<given-names>IFN</given-names>
</name>
<name><surname>Chan</surname>
<given-names>JFW</given-names>
</name>
<name><surname>Yuen</surname>
<given-names>KY</given-names>
</name>
<article-title>From SARS coronavirus to novel animal and human coronaviruses</article-title>
<source>J Thorac Dis</source>
<year>2013</year>
<volume>5</volume>
<issue>(Suppl 2)</issue>
<fpage>S103</fpage>
<lpage>S108</lpage>
<pub-id pub-id-type="pmid">23977429</pub-id>
</mixed-citation>
</ref>
<ref id="B37"><mixed-citation publication-type="journal"><name><surname>Muller</surname>
<given-names>MA</given-names>
</name>
<name><surname>Muller</surname>
<given-names>MA</given-names>
</name>
<name><surname>Stalin</surname>
<given-names>RV</given-names>
</name>
<name><surname>Doreen</surname>
<given-names>M</given-names>
</name>
<name><surname>Benjamin</surname>
<given-names>M</given-names>
</name>
<name><surname>Stephan</surname>
<given-names>K</given-names>
</name>
<name><surname>Saskia</surname>
<given-names>L</given-names>
</name>
<name><surname>Robert</surname>
<given-names>W</given-names>
</name>
<name><surname>Sabine</surname>
<given-names>S</given-names>
</name>
<name><surname>Tasnim</surname>
<given-names>S</given-names>
</name>
<name><surname>Katrin</surname>
<given-names>Z</given-names>
</name>
<name><surname>Tabea</surname>
<given-names>B</given-names>
</name>
<name><surname>Isabella</surname>
<given-names>E</given-names>
</name>
<name><surname>Marco</surname>
<given-names>T</given-names>
</name>
<name><surname>Ali</surname>
<given-names>MZ</given-names>
</name>
<name><surname>Albert</surname>
<given-names>DME</given-names>
</name>
<name><surname>Ron</surname>
<given-names>AM</given-names>
</name>
<name><surname>Bart</surname>
<given-names>LH</given-names>
</name>
<name><surname>Christian</surname>
<given-names>D</given-names>
</name>
<article-title>Human Coronavirus EMC Does Not Require the SARS-Coronavirus Receptor and Maintains Broad Replicative Capability in Mammalian Cell Lines</article-title>
<source>mBio</source>
<year>2012</year>
<volume>3</volume>
<fpage>e00515</fpage>
<lpage>12</lpage>
<pub-id pub-id-type="pmid">23232719</pub-id>
</mixed-citation>
</ref>
<ref id="B38"><mixed-citation publication-type="journal"><name><surname>Yang</surname>
<given-names>ZY</given-names>
</name>
<name><surname>Kong</surname>
<given-names>WP</given-names>
</name>
<name><surname>Huang</surname>
<given-names>Y</given-names>
</name>
<name><surname>Roberts</surname>
<given-names>A</given-names>
</name>
<name><surname>Murphy</surname>
<given-names>BR</given-names>
</name>
<name><surname>Subbarao</surname>
<given-names>K</given-names>
</name>
<name><surname>Nabel</surname>
<given-names>GJ</given-names>
</name>
<article-title>A DNA vaccine induces SARS coronavirus neutralization and protective immunity in mice</article-title>
<source>Nature</source>
<year>2004</year>
<volume>428</volume>
<issue>6982</issue>
<fpage>561</fpage>
<lpage>564</lpage>
<pub-id pub-id-type="doi">10.1038/nature02463</pub-id>
<pub-id pub-id-type="pmid">15024391</pub-id>
</mixed-citation>
</ref>
<ref id="B39"><mixed-citation publication-type="journal"><name><surname>Sudhakar</surname>
<given-names>A</given-names>
</name>
<name><surname>Robin</surname>
<given-names>G</given-names>
</name>
<name><surname>Boyd</surname>
<given-names>L</given-names>
</name>
<name><surname>Agnihothram</surname>
<given-names>S</given-names>
</name>
<name><surname>Gopal</surname>
<given-names>R</given-names>
</name>
<name><surname>Yount</surname>
<given-names>BL</given-names>
<suffix>Jr</suffix>
</name>
<name><surname>Donaldson</surname>
<given-names>EF</given-names>
</name>
<name><surname>Menachery</surname>
<given-names>VD</given-names>
</name>
<name><surname>Graham</surname>
<given-names>RL</given-names>
</name>
<name><surname>Scobey</surname>
<given-names>TD</given-names>
</name>
<name><surname>Gralinski</surname>
<given-names>LE</given-names>
</name>
<name><surname>Denison</surname>
<given-names>MR</given-names>
</name>
<name><surname>Zambon</surname>
<given-names>M</given-names>
</name>
<name><surname>Baric</surname>
<given-names>R</given-names>
</name>
<article-title>Platform strategies for rapid response against emerging coronaviruses: MERS-CoV serologic and antigenic relationships in vaccine design</article-title>
<source>J Infect Dis</source>
<year>2013</year>
<volume>10</volume>
<fpage>1093</fpage>
</mixed-citation>
</ref>
<ref id="B40"><mixed-citation publication-type="journal"><name><surname>Fernando</surname>
<given-names>A</given-names>
</name>
<name><surname>Marta</surname>
<given-names>L</given-names>
</name>
<name><surname>Isabel</surname>
<given-names>S</given-names>
</name>
<name><surname>Sonia</surname>
<given-names>Z</given-names>
</name>
<name><surname>Jose</surname>
<given-names>L</given-names>
</name>
<name><surname>Silvia</surname>
<given-names>LJ</given-names>
</name>
<name><surname>German</surname>
<given-names>A</given-names>
</name>
<name><surname>Luis</surname>
<given-names>E</given-names>
</name>
<article-title>Engineering a replication-competent, propagation defective middle east respiratory syndrome coronavirus as a vaccine candidate</article-title>
<source>mBio</source>
<year>2013</year>
<volume>4</volume>
<issue>5</issue>
<fpage>e00650</fpage>
<lpage>13</lpage>
<pub-id pub-id-type="pmid">24023385</pub-id>
</mixed-citation>
</ref>
<ref id="B41"><mixed-citation publication-type="journal"><name><surname>Pica</surname>
<given-names>N</given-names>
</name>
<name><surname>Palese</surname>
<given-names>P</given-names>
</name>
<article-title>Toward a universal influenza virus vaccine: prospects and challenges</article-title>
<source>Annu Rev Med</source>
<year>2013</year>
<volume>64</volume>
<fpage>189</fpage>
<lpage>202</lpage>
<pub-id pub-id-type="doi">10.1146/annurev-med-120611-145115</pub-id>
<pub-id pub-id-type="pmid">23327522</pub-id>
</mixed-citation>
</ref>
<ref id="B42"><mixed-citation publication-type="other"><name><surname>Elaine</surname>
<given-names>VJ</given-names>
</name>
<name><surname>Sharon</surname>
<given-names>K</given-names>
</name>
<name><surname>Timothy</surname>
<given-names>JM</given-names>
</name>
<name><surname>Albert</surname>
<given-names>PR</given-names>
</name>
<name><surname>Smithkline</surname>
<given-names>BC</given-names>
</name>
<article-title>Universal coronavirus vaccine</article-title>
<source>WIPO Patentscope</source>
<year>1993</year>
<comment>WO1993023421 A1. [<ext-link ext-link-type="uri" xlink:href="http://www.google.com/patents/WO1993023421A1?cl=en">http://www.google.com/patents/WO1993023421A1?cl=en</ext-link>
]</comment>
</mixed-citation>
</ref>
<ref id="B43"><mixed-citation publication-type="journal"><name><surname>Arnon</surname>
<given-names>R</given-names>
</name>
<article-title>A novel approach to vaccine design–epitope-based vaccines</article-title>
<source>FEBS J</source>
<year>2006</year>
<volume>273</volume>
<fpage>33</fpage>
<lpage>34</lpage>
</mixed-citation>
</ref>
<ref id="B44"><mixed-citation publication-type="journal"><name><surname>Olesen</surname>
<given-names>OF</given-names>
</name>
<name><surname>Lonnoroth</surname>
<given-names>A</given-names>
</name>
<name><surname>Mulligan</surname>
<given-names>B</given-names>
</name>
<article-title>Human vaccine research in the European Union</article-title>
<source>Vaccine</source>
<year>2009</year>
<volume>27</volume>
<issue>5</issue>
<fpage>640</fpage>
<lpage>645</lpage>
<pub-id pub-id-type="doi">10.1016/j.vaccine.2008.11.064</pub-id>
<pub-id pub-id-type="pmid">19059446</pub-id>
</mixed-citation>
</ref>
<ref id="B45"><mixed-citation publication-type="journal"><name><surname>Benson</surname>
<given-names>DA</given-names>
</name>
<name><surname>Cavanaugh</surname>
<given-names>M</given-names>
</name>
<name><surname>Clark</surname>
<given-names>K</given-names>
</name>
<name><surname>Karsch-Mizrachi</surname>
<given-names>I</given-names>
</name>
<name><surname>Lipman</surname>
<given-names>DJ</given-names>
</name>
<name><surname>Ostell</surname>
<given-names>J</given-names>
</name>
<name><surname>Sayers</surname>
<given-names>EW</given-names>
</name>
<article-title>GenBank</article-title>
<source>Nucleic Acids Res</source>
<year>2008</year>
<volume>41</volume>
<issue>Database issue</issue>
<fpage>D36</fpage>
<lpage>D42</lpage>
<pub-id pub-id-type="pmid">23193287</pub-id>
</mixed-citation>
</ref>
</ref-list>
</back>
</pmc>
</record>
Pour manipuler ce document sous Unix (Dilib)
EXPLOR_STEP=$WICRI_ROOT/Wicri/Sante/explor/CovidV1/Data/Pmc/Corpus
HfdSelect -h $EXPLOR_STEP/biblio.hfd -nk 000391 | SxmlIndent | more
Ou
HfdSelect -h $EXPLOR_AREA/Data/Pmc/Corpus/biblio.hfd -nk 000391 | SxmlIndent | more
Pour mettre un lien sur cette page dans le réseau Wicri
{{Explor lien |wiki= Wicri/Sante |area= CovidV1 |flux= Pmc |étape= Corpus |type= RBID |clé= |texte= }}
![]() | This area was generated with Dilib version V0.6.33. | ![]() |